@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VV98: (2017-12-23 )
MIDLYYWGTPNGHKITIALEEMGLDYTLYPINILENDQFQPDFLKISPNNKIPAIVDQDGPRGEPISVFESGAILQYLGRKTGLFYPTDEQERVEVEQWLMWQMGGLGPMLGQNHHFNRFAPEKIPYAIDRYVNETKRLYGVLNKQLIRQKFVAGEYSIADMAILPWILRYEWQGIQLEDYPYVQEYIVRLTARPAVQKALSIKVI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BEZ_A_4(4MF6)
?
[Raw transfer]




5 PsiBlast_PDB 91.4750%-134 - C1 -4ECJ - ? -
4 PsiBlast_PDB 90.0450%-130 - C1 -4ECI - ? -
62 HHSearch 87.6558% -51 - C1 -5HFK - YFCG_ECOLI -
2 PsiBlast_PDB 85.3858% -40 - C1 -5HFK - YFCG_ECOLI -
9 PsiBlast_PDB 85.2245% -79 - C1 -4IKH - ? -
59 HHSearch 83.3758% -52 - C1 -3GX0 - YFCG_ECOLI -
3 PsiBlast_PDB 82.3658% -43 - C1 -3GX0 - YFCG_ECOLI -
1 PsiBlast_PDB 81.3461% -28 - C1 -4L8E - ? -
7 PsiBlast_PDB 79.1246% -85 - C1 -4MF5 - ? -
6 PsiBlast_PDB 78.7046% -71 - C1 -4NAX - ? -
10 PsiBlast_PDB 78.5044% -74 - C1 -4NHZ - ? -
24 PsiBlast_CBE 78.4746% -71 - C1 -4NAX - ? -
8 PsiBlast_PDB 78.2046% -83 - C1 -4MF6 3.1 ?
11 PsiBlast_PDB 70.8244% -23 - C1 -3C8E - YGHU_ECOLI -
73 HHSearch 70.1738% -62 - C1 -4IVF - ? -
78 HHSearch 66.9038% -8 - C1 -4ZBD - ? -
72 HHSearch 65.0238% -61 * C1 *4IVF - ? -
57 PsiBlast_CBE 64.0533% -57 - C1 -5O00 - ? -
77 HHSearch 63.9938% -11 - C1 -4ZB8 - ? -
20 PsiBlast_PDB 62.9629% -21 - C1 -1G6W - URE2_YEAST -