@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U1C5: (2017-12-20 )
MKERFQMKKYQWGIVGLGTIAHEFAESFNQETSELTAVASRTSEKAENFAHRYNIPKAYGSYQEMLDDAEIDIVYIAVPNRQHIDHILAALEAGKHVLCEKAITMNKKELADAMRLAEEKNLILAEAMTIFNMPLYQQLRSIMDTGKLGALKMIQAPFGSYKEPDPKNRFFNPELAGGALLDIGTYAVSFARFFLSSQPEVVASTMVPFETGVDEQSVTILRNKENELAAVSLTFQAKMPKVGIVAFENGYVTIADYPRADRAEILFTDGTKEFIESGNTSEAMNYEIKNMVHMIEGDLPNRSLFLTKDVIEILDQMQVLWKNM

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_9(3E18)
?
[Raw transfer]




FMT_B_9(4NHE)
?
[Raw transfer]




2 PsiBlast_PDB 69.0529% -6 - C1 -2O4U - DHDH_MACFA -
1 PsiBlast_PDB 68.5829% -4 * C1 *2O48 - DHDH_MACFA -
3 PsiBlast_PDB 67.8529% -4 - C1 -2POQ - DHDH_MACFA -
4 PsiBlast_PDB 67.3529% -4 - C1 -3OHS - DHDH_MACFA -
69 Fugue 65.3726% -14 - C1 -2O4U - DHDH_MACFA -
86 HHSearch 61.6927% -8 - C1 -3OHS - DHDH_MACFA -
85 HHSearch 60.5927% -9 - C1 -2POQ - DHDH_MACFA -
83 HHSearch 59.4125% -36 - C1 -3E9M - ? -
82 HHSearch 58.9225% -37 - C1 -3E9M - ? -
6 PsiBlast_PDB 58.7128% -26 - C- -3EVN - ? -
81 HHSearch 56.4227% -30 - C- -3EVN - ? -
7 PsiBlast_PDB 56.1827% -24 - C1 -3E9M - ? -
98 HHSearch 55.9126% 8 - C1 -4HAD - ? -
94 HHSearch 55.6823% -29 - C1 -4NHE - ? -
89 HHSearch 52.9221% 2 - C1 -3RC1 - ? -
87 HHSearch 52.1121% 3 - C1 -3RC7 - ? -
92 HHSearch 50.8519% -15 - C1 -3CEA - ? -
5 PsiBlast_PDB 50.2234% -64 - C1 -4HAD - ? -
71 Fugue 49.1522% 29 - C1 -1YDW - Y4967_ARATH -
93 HHSearch 49.1319% -17 - C1 -3CEA - ? -