@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U373: (2017-12-24 )
MTKKIGFFIGSLRKDSYNKKVAEAFAKLLPEGYESVFVKIDDLPFYNEDLETPEQAPAEWTRFREEVRGLDGVVFVTPEYNRSVPAVLKNALDVGSRPYGHSVWDHKPGLVVTASPGGIGGFGANHHLRQSLVFLNVPTLQQPEAYIGNVANLIDENGNIVEGTLSFFQTILDAYLDFSNKLTE

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_D_12(3S2Y)
?
[Raw transfer]




FMN_C_10(3S2Y)
?
[Raw transfer]




FMN_A_5(3S2Y)
?
[Raw transfer]




FNR_B_5(3U7R)
?
[Raw transfer]




FMN_B_8(3S2Y)
?
[Raw transfer]




105 HHSearch 83.4037% -96 - C2 -1X77 - FMNRE_PSEAE -
106 HHSearch 82.7737% -94 - C2 -1RTT - FMNRE_PSEAE -
111 HHSearch 81.2041% -56 * C2 *4HS4 - ? -
110 HHSearch 80.4741% -58 - C2 -4H6P - ? -
1 PsiBlast_PDB 80.0438%-102 - C2 -3U7R - ? -
107 HHSearch 78.7039% -29 - C2 -3SVL - CHRR_ECOLI -
101 HHSearch 78.6738% -99 - C2 -3U7R 8.4 ?
108 HHSearch 76.9639% -33 - C2 -3SVL - CHRR_ECOLI -
3 PsiBlast_PDB 74.3341% -32 - C2 -4HS4 - ? -
28 PsiBlast_CBE 74.2441% -33 - C2 -4HS4 - ? -
2 PsiBlast_PDB 73.9041% -33 - C2 -3S2Y 8.3 ?
21 PsiBlast_CBE 73.7141% -33 - C2 -3S2Y 8.1 ?
27 PsiBlast_CBE 73.6041% -30 - C2 -4HS4 - ? -
40 PsiBlast_CBE 73.4239% -20 - C2 -3SVL - CHRR_ECOLI -
24 PsiBlast_CBE 73.1441% -37 - C2 -4HS4 - ? -
41 PsiBlast_CBE 72.7141% -91 - C2 -1X77 - FMNRE_PSEAE -
23 PsiBlast_CBE 72.5241% -29 - C2 -3S2Y 7.6 ?
26 PsiBlast_CBE 72.5141% -26 - C2 -4HS4 - ? -
25 PsiBlast_CBE 72.4241% -28 - C2 -4HS4 - ? -
5 PsiBlast_PDB 72.2139% -25 - C2 -3SVL - CHRR_ECOLI -
22 PsiBlast_CBE 71.8641% -30 - C2 -3S2Y 7.8 ?