@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XWV5: (2018-01-01 )
MSEVVKVSQLVKKLSLEIVTGDEKSLDRVIVTGDISRPGLELTGYFNYYSHNRLQLFGSKEISFAERMIPEERLIIMRRLCSEDMPAFIISRGLPAPEEMIQAANENGIAVLRSPISTSRLLGELSSYLDGRLAPRTSVHGVLVDVYGLGVLIQGDSGIGKSETALELIKRGHRLIADDRVDVYQQDELTVIGEPPKILEHLIEIRGIGIIDVMNLFGASAVRGSMQVQLAVYLEAWAKDKKYDRLGSEDTTVEIAEVGIPQIKIPVKTGRNVAIIIEVAAMNFRARTMGFDATKTFEERLSRLIEENSGND

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PYR_A_5(1OS1)
PCKA_ECOLI
[Raw transfer]




CO2_A_5(2OLR)
PCKA_ECOLI
[Raw transfer]




OSA_A_4(3N2E)
AROK_HELPY
[Raw transfer]




43 HHSearch 95.5749%-130 - C3 -1KO7 - HPRK_STAXY -
33 Fugue 95.5549%-130 - C3 -1KO7 - HPRK_STAXY -
1 PsiBlast_PDB 95.5549%-130 - C3 -1KO7 - HPRK_STAXY -
46 HHSearch 76.9868%-160 - C3 -2QMH - HPRK_LACCA -
2 PsiBlast_PDB 76.9268%-153 - C3 -1KKL - HPRK_LACCA -
3 PsiBlast_PDB 76.6268%-139 - C3 -1KKM - HPRK_LACCA -
47 HHSearch 76.5468%-148 - C3 -2QMH - HPRK_LACCA -
4 PsiBlast_PDB 75.9667%-159 - C3 -2QMH - HPRK_LACCA -
5 PsiBlast_PDB 73.2667%-156 - C3 -1JB1 - HPRK_LACCA -
45 HHSearch 66.2726% -19 * C3 *1KNX - HPRK_MYCPN -
44 HHSearch 64.7126% -10 - C3 -1KNX - HPRK_MYCPN -
49 HHSearch 60.1035%-116 - C3 -3TQF - ? -
34 Fugue 59.6066% -36 - C3 -1JB1 - HPRK_LACCA -
35 Fugue 59.4768% -28 - C3 -1JB1 - HPRK_LACCA -
6 PsiBlast_PDB 58.9736%-107 - C3 -3TQF - ? -
48 HHSearch 58.2935%-107 - C3 -3TQF - ? -
50 HHSearch 34.8813% -31 - C3 -2IOJ - Y1212_ARCFU -
42 Fugue 31.9115% -7 - C3 -2IOJ - Y1212_ARCFU -
62 HHSearch 30.0625% -96 - C3 -2IF2 - COAE_AQUAE -
61 HHSearch 29.5624% -75 - C3 -3N2E 3.0 AROK_HELPY