@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XX53: (2018-01-02 )
MSDWLDIAGKVVIVTGGSSGIGRSIVENLLKQNAQVANFDVTECRIQHENLLSLKVDVSSKTDIEEGIYKVMKHFKTIDGLVNNAGINIPSLLIDRNHPKSKYELSEQVFDKMIAVNQKSVYLMSQAVGRILVQKGSGVIVNLSSESGLEGSEGQSCYAATKAAMNSFTRSWAKELGKRNVRVVGVAPGILEETGLRTQEYEEALSYTRGISVEQLRNGYSRTSTIPLGRSGKLQEVADLVCYYLSERSSYITGVTTNISGGKTRG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_D_8(4DMM)
?
[Raw transfer]




NAP_B_6(4DMM)
?
[Raw transfer]




EDO_B_22(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_10(3RRO)
FABG_VIBCH
[Raw transfer]




17 PsiBlast_PDB 87.2031% -68 - C1 -4NBT - ? -
48 PsiBlast_CBE 87.1731% -67 - C1 -4NBT - ? -
47 PsiBlast_CBE 86.9531% -64 - C1 -4NBT - ? -
46 PsiBlast_CBE 86.3231% -63 - C1 -4NBT - ? -
139 HHSearch 84.8430% -17 - C1 -4Z9Y - ? -
9 PsiBlast_PDB 82.3631% -1 - C1 -4NBV - ? -
138 HHSearch 81.6530% -22 * C1 *4ZA2 - ? -
55 PsiBlast_CBE 80.9033% 4 - C1 -1EDO - FABG1_BRANA -
60 PsiBlast_CBE 80.0632% 6 - C1 -4K6C - ? -
56 PsiBlast_CBE 79.5132% 8 - C1 -4K6F - ? -
132 HHSearch 79.3727% -9 - C1 -5JY1 - ? -
26 PsiBlast_CBE 78.6332% 14 - C1 -4I08 - FABG_VIBCH -
58 PsiBlast_CBE 78.4032% 6 - C1 -4K6F - ? -
59 PsiBlast_CBE 77.9332% 8 - C1 -4K6C - ? -
118 Fugue 77.8032% -30 - C1 -1AE1 - TRN1_DATST -
57 PsiBlast_CBE 77.6332% 10 - C1 -4K6F - ? -
133 HHSearch 77.1928% -9 - C1 -5U8P - ? -
37 PsiBlast_CBE 77.1833% 18 - C1 -1Q7B - FABG_ECOLI -
16 PsiBlast_PDB 76.8432% 22 - C1 -3U09 - FABG_VIBCH -
8 PsiBlast_PDB 76.7632% 17 - C1 -3TZH - ? -