@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XZP8: (2018-01-16 )
MEDLYLVNQVCFPLYAASKEIIRHYTSLLKPLNLTYTQYLVMLVLWEKKKTSVKELGNDLCLDSGTLTPLLKKLAEKNYINRQRETGDERIVNVTLTPQGAALQKQAEGIPQKIKSYLPLEQEELDTLQHLTRKMLDNFHQDQKKG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMT_A_5(2PEX)
?
[Raw transfer]



FMT_B_3(2PEX)
?
[Raw transfer]
3 PsiBlast_PDB 92.3943%-177 - C1 -1Z91 - OHRR_BACSU -
4 PsiBlast_PDB 90.6043%-162 - C1 -1Z9C - OHRR_BACSU -
30 HHSearch 90.0942%-176 - C1 -1Z91 - OHRR_BACSU -
34 HHSearch 89.1543%-212 - C1 -2PEX - ? -
33 HHSearch 88.3043%-204 - C1 -2PEX - ? -
29 HHSearch 87.8442%-169 - C1 -1Z9C - OHRR_BACSU -
7 PsiBlast_PDB 84.6942%-165 - C1 -4GXO - ? -
24 PsiBlast_CBE 83.3949%-208 - C1 -2PEX 3.1 ?
25 PsiBlast_CBE 82.0042%-185 - C1 -4GXO - ? -
23 PsiBlast_CBE 81.2443%-190 - C1 -3HSR - ? -
6 PsiBlast_PDB 81.0749%-197 - C1 -2PEX 3.1 ?
22 PsiBlast_CBE 80.4043%-191 - C1 -3HSR - ? -
21 PsiBlast_CBE 78.9343%-187 - C1 -3HSR - ? -
8 PsiBlast_PDB 78.2742%-186 - C- -3HRM - ? -
5 PsiBlast_PDB 77.9350%-181 - C1 -2PFB - ? -
2 PsiBlast_PDB 76.4343%-178 - C1 -3HSR - ? -
1 PsiBlast_PDB 70.9243%-190 - C1 -3HSE - ? -
10 PsiBlast_PDB 68.4934% 4 - C1 -2BV6 - MGRA_STAAU -
19 PsiBlast_PDB 65.2032%-158 - C1 -1JGS - MARR_ECOLI -
53 Fugue 64.8818%-140 - C1 -1LJ9 - ? -