@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : HDAC1_HUMAN: (2017-06-15 )
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Atome Classification :

(83 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_15(4A69)
HDAC3_HUMAN
[Raw transfer]




V5X_B_10(2V5X)
HDAC8_HUMAN
[Raw transfer]




NHB_A_6(1W22)
HDAC8_HUMAN
[Raw transfer]




XCH_B_10(5BWZ)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3EW8)
HDAC8_HUMAN
[Raw transfer]




TSN_B_6(1C3R)
?
[Raw transfer]




B3N_B_8(5DC5)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3F06)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(3F0R)
HDAC8_HUMAN
[Raw transfer]




NHB_B_10(1W22)
HDAC8_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3MZ6)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(4QA3)
HDAC8_HUMAN
[Raw transfer]




B3N_B_10(3MZ3)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3MZ7)
HDAC8_HUMAN
[Raw transfer]




SHH_A_3(1T69)
HDAC8_HUMAN
[Raw transfer]




SHH_A_6(4QA2)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA2)
HDAC8_HUMAN
[Raw transfer]




SHH_A_3(1C3S)
?
[Raw transfer]




B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3F06)
HDAC8_HUMAN
[Raw transfer]




TSN_A_5(1C3R)
?
[Raw transfer]




5YA_B_7(5FCW)
?
[Raw transfer]




B3N_B_11(3EZT)
HDAC8_HUMAN
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




GOL_A_7(5DC7)
HDAC8_HUMAN
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




GOL_A_7(5DC6)
HDAC8_HUMAN
[Raw transfer]




GOL_B_11(5D1C)
HDAC8_HUMAN
[Raw transfer]




GOL_D_12(5DC7)
HDAC8_HUMAN
[Raw transfer]




AGE_B_12(3F07)
HDAC8_HUMAN
[Raw transfer]




GOL_D_11(5DC6)
HDAC8_HUMAN
[Raw transfer]




GOL_D_14(4QA6)
HDAC8_HUMAN
[Raw transfer]




CHAIN_D_4(3RQD)
HDAC8_HUMAN
[Raw transfer]

-

20Y_A_10(4LY1)
HDAC2_HUMAN
[Raw transfer]




I6P_A_4(5ICN)
HDAC1_HUMAN
[Raw transfer]




CHAIN_D_4(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

I0P_C_17(4A69)
HDAC3_HUMAN
[Raw transfer]




I0P_C_17(4A69)
HDAC3_HUMAN
[Raw transfer]




CHAIN_C_3(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_C_3(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

I0P_D_18(4A69)
HDAC3_HUMAN
[Raw transfer]




TSN_B_16(1T64)
HDAC8_HUMAN
[Raw transfer]




PGE_B_26(5IX0)
HDAC2_HUMAN
[Raw transfer]




B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




TSN_B_13(3F0R)
HDAC8_HUMAN
[Raw transfer]




PG4_B_18(5IWG)
HDAC2_HUMAN
[Raw transfer]




PG4_C_23(4LY1)
HDAC2_HUMAN
[Raw transfer]




PG4_C_23(4LXZ)
HDAC2_HUMAN
[Raw transfer]




TSN_C_18(3F0R)
HDAC8_HUMAN
[Raw transfer]




PEG_A_8(5IX0)
HDAC2_HUMAN
[Raw transfer]




PG5_A_8(5IWG)
HDAC2_HUMAN
[Raw transfer]




L6G_B_9(4RN0)
HDAC8_HUMAN
[Raw transfer]




V5X_B_10(2V5X)
HDAC8_HUMAN
[Raw transfer]




L8G_B_12(4RN1)
HDAC8_HUMAN
[Raw transfer]




PG5_B_21(5IX0)
HDAC2_HUMAN
[Raw transfer]




L8G_B_12(4RN1)
HDAC8_HUMAN
[Raw transfer]




L6G_B_9(4RN0)
HDAC8_HUMAN
[Raw transfer]




L7G_B_10(4RN2)
HDAC8_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




PG4_A_8(4LY1)
HDAC2_HUMAN
[Raw transfer]




PG4_A_8(4LXZ)
HDAC2_HUMAN
[Raw transfer]




PG4_A_10(5IX0)
HDAC2_HUMAN
[Raw transfer]




B3N_B_8(5DC5)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZT)
HDAC8_HUMAN
[Raw transfer]




NHB_B_10(1W22)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




L7G_B_10(4RN2)
HDAC8_HUMAN
[Raw transfer]




CHAIN_L_5(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_L_8(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_L_8(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




CHAIN_L_5(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_J_6(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_J_6(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_B_2(4QA7)
HDAC8_HUMAN
[Raw transfer]

-

SHH_B_10(4QA2)
HDAC8_HUMAN
[Raw transfer]




2 PsiBlast_PDB 93.30100%-111 - C3 -5ICN 2.9 HDAC1_HUMAN
6 PsiBlast_PDB 92.0993%-111 - C3 -5IWG 2.0 HDAC2_HUMAN
120 HHSearch 92.05100%-110 - C3 -4BKX - HDAC1_HUMAN
1 PsiBlast_PDB 92.05100%-110 - C3 -4BKX - HDAC1_HUMAN -
26 PsiBlast_CBE 92.0093%-114 - C3 -5IX0 2.3 HDAC2_HUMAN
5 PsiBlast_PDB 91.9293%-110 - C3 -5IX0 1.9 HDAC2_HUMAN
3 PsiBlast_PDB 91.8593%-112 - C3 -4LXZ 2.0 HDAC2_HUMAN
27 PsiBlast_CBE 91.7793%-116 - C3 -5IWG - HDAC2_HUMAN
124 HHSearch 91.4994%-111 - C3 -4LY1 7.6 HDAC2_HUMAN
25 PsiBlast_CBE 91.4993%-117 - C3 -5IX0 - HDAC2_HUMAN
4 PsiBlast_PDB 91.2893%-111 - C3 -4LY1 2.0 HDAC2_HUMAN
28 PsiBlast_CBE 91.2793%-112 - C3 -5IWG 1.8 HDAC2_HUMAN
22 PsiBlast_CBE 90.8693%-112 - C3 -4LY1 2.5 HDAC2_HUMAN
7 PsiBlast_PDB 90.7593%-111 - C3 -3MAX - HDAC2_HUMAN
24 PsiBlast_CBE 90.6993%-110 - C3 -4LXZ 1.7 HDAC2_HUMAN
30 PsiBlast_CBE 90.4293%-114 - C3 -3MAX - HDAC2_HUMAN
23 PsiBlast_CBE 89.9593%-111 - C3 -4LXZ - HDAC2_HUMAN
21 PsiBlast_CBE 89.9193%-113 - C3 -4LY1 - HDAC2_HUMAN
29 PsiBlast_CBE 89.7193%-112 - C3 -3MAX - HDAC2_HUMAN
123 HHSearch 79.6164% -71 - C3 -4A69 2.6 HDAC3_HUMAN
31 PsiBlast_CBE 79.3263% -71 - C3 -4A69 2.4 HDAC3_HUMAN
8 PsiBlast_PDB 79.2363% -71 - C3 -4A69 2.6 HDAC3_HUMAN
122 HHSearch 66.3339% -70 - C3 -5DC8 2.2 HDAC8_HUMAN
140 Fugue 65.4740% -68 - C3 -4QA5 4.4 HDAC8_HUMAN
95 PsiBlast_CBE 63.5642% -60 - C3 -4QA6 4.6 HDAC8_HUMAN
86 PsiBlast_CBE 63.5442% -63 - C3 -3MZ4 2.8 HDAC8_HUMAN
76 PsiBlast_CBE 63.4342% -56 - C3 -4QA2 4.1 HDAC8_HUMAN
42 PsiBlast_CBE 63.1343% -61 - C3 -1W22 4.9 HDAC8_HUMAN
32 PsiBlast_CBE 63.1243% -57 - C3 -4QA3 4.6 HDAC8_HUMAN
89 PsiBlast_CBE 63.0442% -59 - C3 -5DC7 2.8 HDAC8_HUMAN
55 PsiBlast_CBE 63.0242% -61 - C3 -4QA7 4.8 HDAC8_HUMAN
75 PsiBlast_CBE 63.0042% -59 - C3 -5D1B 2.4 HDAC8_HUMAN
50 PsiBlast_CBE 62.9343% -58 - C3 -4RN1 3.0 HDAC8_HUMAN
83 PsiBlast_CBE 62.7642% -63 - C3 -5DC6 2.2 HDAC8_HUMAN
77 PsiBlast_CBE 62.7242% -61 - C3 -4QA2 3.8 HDAC8_HUMAN
35 PsiBlast_CBE 62.6743% -62 - C3 -5BWZ 5.1 HDAC8_HUMAN
90 PsiBlast_CBE 62.6542% -59 - C3 -5DC7 2.2 HDAC8_HUMAN
49 PsiBlast_CBE 62.6243% -57 - C3 -4RN1 3.3 HDAC8_HUMAN
88 PsiBlast_CBE 62.6142% -59 - C3 -3EW8 3.4 HDAC8_HUMAN
69 PsiBlast_CBE 62.5142% -63 - C3 -3EZP 2.6 HDAC8_HUMAN
97 PsiBlast_CBE 62.5042% -61 - C3 -4QA0 4.9 HDAC8_HUMAN
87 PsiBlast_CBE 62.5042% -61 - C3 -3MZ4 3.8 HDAC8_HUMAN
96 PsiBlast_CBE 62.4242% -59 - C3 -4QA6 2.0 HDAC8_HUMAN
81 PsiBlast_CBE 62.3342% -58 - C3 -3EWF 1.8 HDAC8_HUMAN
80 PsiBlast_CBE 62.3142% -57 - C3 -3EWF 4.6 HDAC8_HUMAN
70 PsiBlast_CBE 62.3142% -62 - C3 -3F06 3.7 HDAC8_HUMAN
65 PsiBlast_CBE 62.2742% -61 - C3 -3EZT 3.7 HDAC8_HUMAN
54 PsiBlast_CBE 62.2643% -58 - C3 -2V5X 3.0 HDAC8_HUMAN
79 PsiBlast_CBE 62.2542% -57 - C3 -3EWF 1.5 HDAC8_HUMAN
85 PsiBlast_CBE 62.2242% -58 - C3 -3MZ6 3.4 HDAC8_HUMAN
48 PsiBlast_CBE 62.2143% -58 - C3 -4RN2 4.2 HDAC8_HUMAN
37 PsiBlast_CBE 62.2043% -60 - C3 -3F0R 4.5 HDAC8_HUMAN
47 PsiBlast_CBE 62.1943% -59 - C3 -4RN2 3.4 HDAC8_HUMAN
38 PsiBlast_CBE 62.1343% -53 - C3 -3F0R 4.6 HDAC8_HUMAN
74 PsiBlast_CBE 62.1142% -59 - C3 -5D1B 4.6 HDAC8_HUMAN
68 PsiBlast_CBE 62.1142% -62 - C3 -3EZP 3.7 HDAC8_HUMAN
45 PsiBlast_CBE 62.0643% -59 - C3 -1T69 2.8 HDAC8_HUMAN
98 PsiBlast_CBE 62.0142% -58 * C3 *4QA0 3.8 HDAC8_HUMAN
94 PsiBlast_CBE 61.9542% -59 - C3 -5DC8 2.2 HDAC8_HUMAN
64 PsiBlast_CBE 61.9542% -60 - C3 -3EZT 3.8 HDAC8_HUMAN
40 PsiBlast_CBE 61.9543% -56 - C3 -3F07 5.0 HDAC8_HUMAN
51 PsiBlast_CBE 61.8843% -59 - C3 -4RN0 3.6 HDAC8_HUMAN
36 PsiBlast_CBE 61.8543% -63 - C3 -5FCW 4.6 ?
91 PsiBlast_CBE 61.8242% -58 - C3 -5D1C 2.2 HDAC8_HUMAN
46 PsiBlast_CBE 61.7843% -58 - C3 -1T64 4.9 HDAC8_HUMAN
82 PsiBlast_CBE 61.7642% -61 - C3 -5DC6 2.9 HDAC8_HUMAN
56 PsiBlast_CBE 61.7342% -59 - C3 -2V5W 6.3 HDAC8_HUMAN
71 PsiBlast_CBE 61.6742% -62 - C3 -3F06 3.7 HDAC8_HUMAN
57 PsiBlast_CBE 61.6742% -57 - C3 -2V5W 2.1 HDAC8_HUMAN
72 PsiBlast_CBE 61.5742% -58 - C3 -4QA5 4.5 HDAC8_HUMAN
33 PsiBlast_CBE 61.5743% -61 - C3 -3RQD 5.1 HDAC8_HUMAN
84 PsiBlast_CBE 61.5442% -60 - C3 -3MZ7 3.2 HDAC8_HUMAN
52 PsiBlast_CBE 61.5243% -61 - C3 -4RN0 3.9 HDAC8_HUMAN
63 PsiBlast_CBE 61.4442% -57 - C3 -5DC5 2.5 HDAC8_HUMAN
78 PsiBlast_CBE 61.3542% -57 - C3 -3EWF 4.5 HDAC8_HUMAN
62 PsiBlast_CBE 61.2842% -60 - C3 -5DC5 4.8 HDAC8_HUMAN
53 PsiBlast_CBE 61.2243% -61 - C3 -2V5X 5.6 HDAC8_HUMAN
41 PsiBlast_CBE 60.0343% -59 - C3 -1W22 4.0 HDAC8_HUMAN
73 PsiBlast_CBE 60.0142% -57 - C3 -4QA5 4.4 HDAC8_HUMAN
34 PsiBlast_CBE 59.7243% -60 - C3 -3MZ3 3.8 HDAC8_HUMAN
114 PsiBlast_CBE 49.5236% -5 - C3 -1C3R 5.6 ?
115 PsiBlast_CBE 49.3736% -5 - C3 -1C3R 5.7 ?
113 PsiBlast_CBE 48.0636% -5 - C3 -1C3S 4.7 ?