@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : HDAC2_HUMAN: (2017-06-15 )
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP

Atome Classification :

(84 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_15(4A69)
HDAC3_HUMAN
[Raw transfer]




V5X_B_10(2V5X)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3F06)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3EW8)
HDAC8_HUMAN
[Raw transfer]




B3N_B_8(5DC5)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(3F0R)
HDAC8_HUMAN
[Raw transfer]




TSN_B_6(1C3R)
?
[Raw transfer]




XCH_B_10(5BWZ)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




NHB_B_10(1W22)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(4QA3)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3MZ6)
HDAC8_HUMAN
[Raw transfer]




NHB_A_6(1W22)
HDAC8_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3MZ7)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




SHH_A_3(1C3S)
?
[Raw transfer]




SHH_A_6(4QA2)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA2)
HDAC8_HUMAN
[Raw transfer]




B3N_B_10(3MZ3)
HDAC8_HUMAN
[Raw transfer]




5YA_B_7(5FCW)
?
[Raw transfer]




B3N_A_6(3F06)
HDAC8_HUMAN
[Raw transfer]




TSN_A_5(1C3R)
?
[Raw transfer]




B3N_B_11(3EZT)
HDAC8_HUMAN
[Raw transfer]




GOL_A_7(5DC7)
HDAC8_HUMAN
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




GOL_A_7(5DC6)
HDAC8_HUMAN
[Raw transfer]




GOL_B_11(5D1C)
HDAC8_HUMAN
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




GOL_D_11(5DC6)
HDAC8_HUMAN
[Raw transfer]




AGE_B_12(3F07)
HDAC8_HUMAN
[Raw transfer]




GOL_D_12(5DC7)
HDAC8_HUMAN
[Raw transfer]




GOL_D_14(4QA6)
HDAC8_HUMAN
[Raw transfer]




20Y_A_10(4LY1)
HDAC2_HUMAN
[Raw transfer]




1DI_A_8(3SFH)
HDAC8_HUMAN
[Raw transfer]




I6P_A_4(5ICN)
HDAC1_HUMAN
[Raw transfer]




I0P_C_17(4A69)
HDAC3_HUMAN
[Raw transfer]




I0P_C_17(4A69)
HDAC3_HUMAN
[Raw transfer]




0DI_A_2(3SFF)
HDAC8_HUMAN
[Raw transfer]




CHAIN_C_3(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_C_3(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

I0P_D_18(4A69)
HDAC3_HUMAN
[Raw transfer]




PGE_B_26(5IX0)
HDAC2_HUMAN
[Raw transfer]




TSN_B_16(1T64)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




TSN_B_13(3F0R)
HDAC8_HUMAN
[Raw transfer]




TSN_C_18(3F0R)
HDAC8_HUMAN
[Raw transfer]




PG4_C_23(4LXZ)
HDAC2_HUMAN
[Raw transfer]




PG4_C_23(4LY1)
HDAC2_HUMAN
[Raw transfer]




CHAIN_D_4(3RQD)
HDAC8_HUMAN
[Raw transfer]

-

PG4_B_18(5IWG)
HDAC2_HUMAN
[Raw transfer]




V5X_B_10(2V5X)
HDAC8_HUMAN
[Raw transfer]




PEG_A_8(5IX0)
HDAC2_HUMAN
[Raw transfer]




PG5_A_8(5IWG)
HDAC2_HUMAN
[Raw transfer]




L6G_B_9(4RN0)
HDAC8_HUMAN
[Raw transfer]




L8G_B_12(4RN1)
HDAC8_HUMAN
[Raw transfer]




L8G_B_12(4RN1)
HDAC8_HUMAN
[Raw transfer]




PG5_B_21(5IX0)
HDAC2_HUMAN
[Raw transfer]




PG4_A_10(5IX0)
HDAC2_HUMAN
[Raw transfer]




PG4_A_8(4LXZ)
HDAC2_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




L6G_B_9(4RN0)
HDAC8_HUMAN
[Raw transfer]




PG4_A_8(4LY1)
HDAC2_HUMAN
[Raw transfer]




L7G_B_10(4RN2)
HDAC8_HUMAN
[Raw transfer]




NHB_B_10(1W22)
HDAC8_HUMAN
[Raw transfer]




B3N_B_8(5DC5)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




L7G_B_10(4RN2)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZT)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA2)
HDAC8_HUMAN
[Raw transfer]




CHAIN_L_8(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_L_5(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_J_6(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_L_8(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_B_2(4QA7)
HDAC8_HUMAN
[Raw transfer]

-

SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




CHAIN_L_5(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_J_6(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

2 PsiBlast_PDB 94.90100%-114 - C2 -4LXZ 2.0 HDAC2_HUMAN
5 PsiBlast_PDB 94.44100%-114 - C2 -5IWG 2.0 HDAC2_HUMAN
27 PsiBlast_CBE 94.35100%-119 - C2 -5IWG - HDAC2_HUMAN
26 PsiBlast_CBE 94.26100%-116 - C2 -5IX0 2.3 HDAC2_HUMAN
3 PsiBlast_PDB 94.15100%-113 - C2 -4LY1 2.0 HDAC2_HUMAN
4 PsiBlast_PDB 94.10100%-113 - C2 -5IX0 1.9 HDAC2_HUMAN
25 PsiBlast_CBE 94.02100%-119 - C2 -5IX0 - HDAC2_HUMAN
123 HHSearch 93.92100%-114 - C2 -4LY1 7.6 HDAC2_HUMAN
28 PsiBlast_CBE 93.82100%-114 - C2 -5IWG 1.8 HDAC2_HUMAN
6 PsiBlast_PDB 93.3399%-114 - C2 -3MAX - HDAC2_HUMAN
22 PsiBlast_CBE 93.15100%-114 - C2 -4LY1 2.5 HDAC2_HUMAN
23 PsiBlast_CBE 92.96100%-114 - C2 -4LXZ - HDAC2_HUMAN
24 PsiBlast_CBE 92.64100%-113 - C2 -4LXZ 1.7 HDAC2_HUMAN
29 PsiBlast_CBE 92.6099%-113 - C2 -3MAX - HDAC2_HUMAN
30 PsiBlast_CBE 92.5799%-118 - C2 -3MAX - HDAC2_HUMAN
21 PsiBlast_CBE 92.29100%-115 - C2 -4LY1 - HDAC2_HUMAN
7 PsiBlast_PDB 92.0292%-113 - C2 -5ICN 2.9 HDAC1_HUMAN
1 PsiBlast_PDB 90.0990%-112 - C2 -4BKX - HDAC1_HUMAN
120 HHSearch 89.2886%-112 - C2 -4BKX - HDAC1_HUMAN -
124 HHSearch 79.2063% -73 - C2 -4A69 2.6 HDAC3_HUMAN
8 PsiBlast_PDB 79.0863% -73 - C2 -4A69 2.6 HDAC3_HUMAN
31 PsiBlast_CBE 78.6763% -72 - C2 -4A69 2.4 HDAC3_HUMAN
122 HHSearch 67.0440% -72 - C2 -5DC8 2.2 HDAC8_HUMAN
140 Fugue 64.3140% -70 - C2 -4QA5 4.4 HDAC8_HUMAN
86 PsiBlast_CBE 63.1143% -65 - C2 -3MZ4 2.8 HDAC8_HUMAN
88 PsiBlast_CBE 62.5743% -61 - C2 -3EW8 3.4 HDAC8_HUMAN
76 PsiBlast_CBE 62.4143% -58 - C2 -4QA2 4.1 HDAC8_HUMAN
93 PsiBlast_CBE 62.0542% -62 - C2 -4QA6 4.6 HDAC8_HUMAN
77 PsiBlast_CBE 61.9243% -63 - C2 -4QA2 3.8 HDAC8_HUMAN
87 PsiBlast_CBE 61.9143% -63 - C2 -3MZ4 3.8 HDAC8_HUMAN
95 PsiBlast_CBE 61.8943% -63 - C2 -4QA0 4.9 HDAC8_HUMAN
52 PsiBlast_CBE 61.8943% -61 - C2 -4RN1 3.0 HDAC8_HUMAN
85 PsiBlast_CBE 61.8143% -61 - C2 -3MZ6 3.4 HDAC8_HUMAN
65 PsiBlast_CBE 61.7143% -63 - C2 -4QA7 4.8 HDAC8_HUMAN
73 PsiBlast_CBE 61.6943% -61 - C2 -5D1B 2.4 HDAC8_HUMAN
90 PsiBlast_CBE 61.6542% -62 - C2 -5DC7 2.2 HDAC8_HUMAN
51 PsiBlast_CBE 61.6143% -59 - C2 -4RN1 3.3 HDAC8_HUMAN
89 PsiBlast_CBE 61.4742% -62 - C2 -5DC7 2.8 HDAC8_HUMAN
79 PsiBlast_CBE 61.4742% -65 - C2 -5DC6 2.2 HDAC8_HUMAN
32 PsiBlast_CBE 61.4543% -60 - C2 -4QA3 4.6 HDAC8_HUMAN
82 PsiBlast_CBE 61.4343% -60 - C2 -3EWF 4.6 HDAC8_HUMAN
72 PsiBlast_CBE 61.3243% -61 - C2 -5D1B 4.6 HDAC8_HUMAN
38 PsiBlast_CBE 61.2243% -55 - C2 -3F0R 4.6 HDAC8_HUMAN
42 PsiBlast_CBE 61.2043% -62 - C2 -1W22 4.9 HDAC8_HUMAN
55 PsiBlast_CBE 61.1443% -61 - C2 -2V5W 6.3 HDAC8_HUMAN
36 PsiBlast_CBE 61.1043% -64 - C2 -5BWZ 5.1 HDAC8_HUMAN
70 PsiBlast_CBE 61.0643% -64 - C2 -3F06 3.7 HDAC8_HUMAN
96 PsiBlast_CBE 61.0043% -60 * C2 *4QA0 3.8 HDAC8_HUMAN
49 PsiBlast_CBE 60.9943% -62 - C2 -4RN2 3.4 HDAC8_HUMAN
37 PsiBlast_CBE 60.9843% -62 - C2 -3F0R 4.5 HDAC8_HUMAN
83 PsiBlast_CBE 60.9743% -60 - C2 -3EWF 1.8 HDAC8_HUMAN
81 PsiBlast_CBE 60.9443% -59 - C2 -3EWF 1.5 HDAC8_HUMAN
50 PsiBlast_CBE 60.9243% -60 - C2 -4RN2 4.2 HDAC8_HUMAN
44 PsiBlast_CBE 60.9143% -60 - C2 -1T64 4.9 HDAC8_HUMAN
64 PsiBlast_CBE 60.8843% -60 - C2 -5DC5 2.5 HDAC8_HUMAN
56 PsiBlast_CBE 60.8143% -59 - C2 -2V5W 2.1 HDAC8_HUMAN
66 PsiBlast_CBE 60.7943% -62 - C2 -3EZT 3.8 HDAC8_HUMAN
98 PsiBlast_CBE 60.7842% -61 - C2 -5DC8 2.2 HDAC8_HUMAN
78 PsiBlast_CBE 60.7842% -63 - C2 -5DC6 2.9 HDAC8_HUMAN
40 PsiBlast_CBE 60.7843% -57 - C2 -3F07 5.0 HDAC8_HUMAN
67 PsiBlast_CBE 60.7743% -62 - C2 -3EZT 3.7 HDAC8_HUMAN
74 PsiBlast_CBE 60.7442% -61 - C2 -4QA5 4.5 HDAC8_HUMAN
54 PsiBlast_CBE 60.7443% -63 - C2 -4RN0 3.9 HDAC8_HUMAN
48 PsiBlast_CBE 60.6643% -60 - C2 -2V5X 3.0 HDAC8_HUMAN
35 PsiBlast_CBE 60.4043% -65 - C2 -5FCW 4.6 ?
68 PsiBlast_CBE 60.3543% -64 - C2 -3EZP 3.7 HDAC8_HUMAN
91 PsiBlast_CBE 60.2542% -61 - C2 -5D1C 2.2 HDAC8_HUMAN
84 PsiBlast_CBE 60.2243% -62 - C2 -3MZ7 3.2 HDAC8_HUMAN
94 PsiBlast_CBE 60.1442% -61 - C2 -4QA6 2.0 HDAC8_HUMAN
33 PsiBlast_CBE 60.0943% -63 - C2 -3RQD 5.1 HDAC8_HUMAN
71 PsiBlast_CBE 60.0243% -64 - C2 -3F06 3.7 HDAC8_HUMAN
69 PsiBlast_CBE 60.0243% -65 - C2 -3EZP 2.6 HDAC8_HUMAN
53 PsiBlast_CBE 60.0143% -61 - C2 -4RN0 3.6 HDAC8_HUMAN
80 PsiBlast_CBE 59.9843% -59 - C2 -3EWF 4.5 HDAC8_HUMAN
63 PsiBlast_CBE 59.8843% -62 - C2 -5DC5 4.8 HDAC8_HUMAN
45 PsiBlast_CBE 59.7243% -60 - C2 -3SFH 6.6 HDAC8_HUMAN
34 PsiBlast_CBE 59.1043% -62 - C2 -3MZ3 3.8 HDAC8_HUMAN
47 PsiBlast_CBE 58.8143% -63 - C2 -2V5X 5.6 HDAC8_HUMAN
41 PsiBlast_CBE 58.6643% -61 - C2 -1W22 4.0 HDAC8_HUMAN
75 PsiBlast_CBE 58.4442% -60 - C2 -4QA5 4.4 HDAC8_HUMAN
46 PsiBlast_CBE 58.0843% -64 - C2 -3SFF 6.7 HDAC8_HUMAN
115 PsiBlast_CBE 50.8035% -15 - C2 -1C3R 5.7 ?
114 PsiBlast_CBE 50.3035% -15 - C2 -1C3R 5.8 ?
113 PsiBlast_CBE 49.6935% -14 - C2 -1C3S 4.7 ?