@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : HDAC3_HUMAN: (2017-06-15 )
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Atome Classification :

(118 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LLX_C_16(3MAX)
HDAC2_HUMAN
[Raw transfer]




6EZ_B_17(5IX0)
HDAC2_HUMAN
[Raw transfer]




LLX_B_12(3MAX)
HDAC2_HUMAN
[Raw transfer]




IWX_B_13(5IWG)
HDAC2_HUMAN
[Raw transfer]




LLX_A_7(3MAX)
HDAC2_HUMAN
[Raw transfer]




5YA_A_3(5FCW)
?
[Raw transfer]




SHH_B_18(4LXZ)
HDAC2_HUMAN
[Raw transfer]




IWX_A_6(5IWG)
HDAC2_HUMAN
[Raw transfer]




6EZ_A_7(5IX0)
HDAC2_HUMAN
[Raw transfer]




SHH_C_24(4LXZ)
HDAC2_HUMAN
[Raw transfer]




IWX_C_21(5IWG)
HDAC2_HUMAN
[Raw transfer]




SHH_A_10(4LXZ)
HDAC2_HUMAN
[Raw transfer]




20Y_B_18(4LY1)
HDAC2_HUMAN
[Raw transfer]




20Y_C_24(4LY1)
HDAC2_HUMAN
[Raw transfer]




V5X_B_10(2V5X)
HDAC8_HUMAN
[Raw transfer]




XCH_B_10(5BWZ)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(3F0R)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3F06)
HDAC8_HUMAN
[Raw transfer]




XCH_A_6(5BWZ)
HDAC8_HUMAN
[Raw transfer]




B3N_A_2(4QA4)
HDAC8_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(1T67)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




B3N_B_8(5DC5)
HDAC8_HUMAN
[Raw transfer]




20Y_A_10(4LY1)
HDAC2_HUMAN
[Raw transfer]




SHH_B_10(4QA2)
HDAC8_HUMAN
[Raw transfer]




TSN_B_6(1C3R)
?
[Raw transfer]




B3N_A_5(3MZ6)
HDAC8_HUMAN
[Raw transfer]




SHH_A_3(1T69)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(4QA3)
HDAC8_HUMAN
[Raw transfer]




20Y_A_10(4LY1)
HDAC2_HUMAN
[Raw transfer]




SHH_A_3(1C3S)
?
[Raw transfer]




B3N_B_10(3MZ3)
HDAC8_HUMAN
[Raw transfer]




NHB_A_6(1W22)
HDAC8_HUMAN
[Raw transfer]




NHB_B_10(1W22)
HDAC8_HUMAN
[Raw transfer]




TSN_A_3(4QA3)
HDAC8_HUMAN
[Raw transfer]




TSN_A_8(3F0R)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3EW8)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3MZ7)
HDAC8_HUMAN
[Raw transfer]




AGE_B_12(3F07)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3F06)
HDAC8_HUMAN
[Raw transfer]




TSN_A_5(1C3R)
?
[Raw transfer]




AGE_A_8(3F07)
HDAC8_HUMAN
[Raw transfer]




5YA_B_7(5FCW)
?
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




GOL_B_11(5D1C)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZT)
HDAC8_HUMAN
[Raw transfer]




GOL_D_11(5DC6)
HDAC8_HUMAN
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




GOL_B_7(4QA7)
HDAC8_HUMAN
[Raw transfer]




GOL_A_7(5DC6)
HDAC8_HUMAN
[Raw transfer]




GOL_A_7(5DC7)
HDAC8_HUMAN
[Raw transfer]




HA3_A_6(2VQV)
HDAC4_HUMAN
[Raw transfer]




GOL_D_12(5DC7)
HDAC8_HUMAN
[Raw transfer]




HA3_B_13(2VQV)

[Raw transfer]




9F4_B_7(4CBT)
HDAC4_HUMAN
[Raw transfer]




9F4_A_4(4CBT)
HDAC4_HUMAN
[Raw transfer]




9F4_C_10(4CBT)

[Raw transfer]




OTF_B_7(5A2S)

[Raw transfer]




1DI_A_8(3SFH)
HDAC8_HUMAN
[Raw transfer]




OTF_A_3(5A2S)
HDAC4_HUMAN
[Raw transfer]




TFG_B_12(2VQO)

[Raw transfer]




TFG_B_12(2VQQ)

[Raw transfer]




TFG_A_7(2VQQ)
HDAC4_HUMAN
[Raw transfer]




SHH_A_16(3C0Z)
HDAC7_HUMAN
[Raw transfer]




SHH_C_18(3C0Z)

[Raw transfer]




0DI_A_2(3SFF)
HDAC8_HUMAN
[Raw transfer]




HA3_A_4(2VQM)

[Raw transfer]




TSN_C_18(3C10)

[Raw transfer]




NU9_A_8(3ZNR)
HDAC7_HUMAN
[Raw transfer]




TSN_B_17(3C10)
HDAC7_HUMAN
[Raw transfer]




I0P_C_17(4A69)
HDAC3_HUMAN
[Raw transfer]




TFG_A_7(2VQO)
HDAC4_HUMAN
[Raw transfer]




TSN_A_16(3C10)
HDAC7_HUMAN
[Raw transfer]




I0P_D_18(4A69)
HDAC3_HUMAN
[Raw transfer]




CHAIN_D_4(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

TFG_A_8(2VQJ)

[Raw transfer]




CHAIN_C_3(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_C_3(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

SHH_B_17(3C0Z)
HDAC7_HUMAN
[Raw transfer]




NU7_A_8(3ZNS)
HDAC7_HUMAN
[Raw transfer]




NU7_B_13(3ZNS)
HDAC7_HUMAN
[Raw transfer]




TSN_B_16(1T64)
HDAC8_HUMAN
[Raw transfer]




NU7_C_18(3ZNS)

[Raw transfer]




TSN_B_13(3F0R)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




V5X_B_10(2V5X)
HDAC8_HUMAN
[Raw transfer]




CHAIN_D_4(3RQD)
HDAC8_HUMAN
[Raw transfer]

-

TSN_C_18(3F0R)
HDAC8_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




TSN_A_14(1T64)
HDAC8_HUMAN
[Raw transfer]




L6G_B_9(4RN0)
HDAC8_HUMAN
[Raw transfer]




L8G_A_6(4RN1)
HDAC8_HUMAN
[Raw transfer]




B3N_B_8(5DC5)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(4QA3)
HDAC8_HUMAN
[Raw transfer]




L7G_A_6(4RN2)
HDAC8_HUMAN
[Raw transfer]




PG4_B_15(4LXZ)
HDAC2_HUMAN
[Raw transfer]




5YA_B_11(5FCW)
?
[Raw transfer]




L6G_B_9(4RN0)
HDAC8_HUMAN
[Raw transfer]




B3N_B_10(3MZ3)
HDAC8_HUMAN
[Raw transfer]




L7G_B_10(4RN2)
HDAC8_HUMAN
[Raw transfer]




L8G_B_12(4RN1)
HDAC8_HUMAN
[Raw transfer]




CHAIN_I_5(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_J_6(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




CHAIN_K_7(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA2)
HDAC8_HUMAN
[Raw transfer]




CHAIN_L_8(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

B3N_B_11(3EZT)
HDAC8_HUMAN
[Raw transfer]




CHAIN_B_2(4QA7)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_L_5(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_I_4(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_C_3(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(3RQD)
HDAC8_HUMAN
[Raw transfer]

-

21 PsiBlast_CBE 95.56100%-144 - C2 -4A69 2.5 HDAC3_HUMAN
152 HHSearch 95.40100%-144 - C2 -4A69 2.8 HDAC3_HUMAN
1 PsiBlast_PDB 95.40100%-144 - C2 -4A69 - HDAC3_HUMAN -
3 PsiBlast_PDB 83.9063%-122 - C2 -5ICN - HDAC1_HUMAN
2 PsiBlast_PDB 83.2062%-121 - C2 -4BKX - HDAC1_HUMAN
4 PsiBlast_PDB 83.1463%-124 - C2 -4LXZ 5.7 HDAC2_HUMAN
23 PsiBlast_CBE 82.9163%-126 - C2 -4LY1 7.9 HDAC2_HUMAN
7 PsiBlast_PDB 82.8463%-124 - C2 -5IX0 7.6 HDAC2_HUMAN
29 PsiBlast_CBE 82.7763%-127 - C2 -5IX0 8.3 HDAC2_HUMAN
31 PsiBlast_CBE 82.4663%-124 - C2 -5IWG 7.5 HDAC2_HUMAN
22 PsiBlast_CBE 82.3963%-125 - C2 -4LY1 7.9 HDAC2_HUMAN
26 PsiBlast_CBE 82.3263%-125 - C2 -3MAX 7.9 HDAC2_HUMAN
30 PsiBlast_CBE 82.2863%-128 - C2 -5IWG 7.0 HDAC2_HUMAN
149 HHSearch 82.2259%-121 - C2 -4BKX - HDAC1_HUMAN -
5 PsiBlast_PDB 82.1363%-124 - C2 -4LY1 7.8 HDAC2_HUMAN
28 PsiBlast_CBE 82.0563%-128 - C2 -5IX0 - HDAC2_HUMAN
6 PsiBlast_PDB 81.9963%-125 - C2 -3MAX 7.9 HDAC2_HUMAN
25 PsiBlast_CBE 81.9563%-124 - C2 -4LXZ 5.6 HDAC2_HUMAN
24 PsiBlast_CBE 81.5463%-125 - C2 -4LXZ 5.5 HDAC2_HUMAN
8 PsiBlast_PDB 81.3463%-125 - C2 -5IWG 7.0 HDAC2_HUMAN
27 PsiBlast_CBE 81.1963%-127 - C2 -3MAX 8.1 HDAC2_HUMAN
153 HHSearch 80.5463%-123 - C2 -4LY1 7.7 HDAC2_HUMAN
170 Fugue 73.8640%-133 - C2 -4QA5 4.6 HDAC8_HUMAN
151 HHSearch 73.6940%-135 - C2 -5DC8 2.2 HDAC8_HUMAN
97 PsiBlast_CBE 70.7742%-130 - C2 -4QA0 4.8 HDAC8_HUMAN
19 PsiBlast_PDB 70.6443%-125 - C2 -3F07 4.3 HDAC8_HUMAN
14 PsiBlast_PDB 70.6243%-130 - C2 -1T69 2.9 HDAC8_HUMAN
38 PsiBlast_CBE 70.4343%-124 - C2 -3F0R 4.5 HDAC8_HUMAN
20 PsiBlast_PDB 69.9243%-127 - C2 -3F0R 4.4 HDAC8_HUMAN
16 PsiBlast_PDB 69.6943%-130 - C2 -1W22 4.0 HDAC8_HUMAN
40 PsiBlast_CBE 69.5743%-126 - C2 -3F07 4.7 HDAC8_HUMAN
87 PsiBlast_CBE 69.4542%-132 - C2 -3MZ7 3.0 HDAC8_HUMAN
78 PsiBlast_CBE 69.3542%-128 - C2 -4QA5 5.2 HDAC8_HUMAN
13 PsiBlast_PDB 69.3243%-132 - C2 -1T67 4.1 HDAC8_HUMAN
47 PsiBlast_CBE 69.3142%-131 - C2 -4QA7 4.9 HDAC8_HUMAN
49 PsiBlast_CBE 69.2143%-127 - C2 -2V5X 3.1 HDAC8_HUMAN
42 PsiBlast_CBE 69.0643%-132 - C2 -3RQD 4.3 HDAC8_HUMAN
80 PsiBlast_CBE 69.0142%-128 - C2 -5D1B 4.2 HDAC8_HUMAN
50 PsiBlast_CBE 68.9642%-125 - C2 -2V5W 6.3 HDAC8_HUMAN
17 PsiBlast_PDB 68.9343%-129 - C2 -4QA3 4.6 HDAC8_HUMAN
76 PsiBlast_CBE 68.9242%-125 - C2 -3EWF 4.8 HDAC8_HUMAN
91 PsiBlast_CBE 68.8442%-129 - C2 -5DC7 2.8 HDAC8_HUMAN
51 PsiBlast_CBE 68.8142%-126 - C2 -2V5W 6.7 HDAC8_HUMAN
89 PsiBlast_CBE 68.8042%-131 - C2 -3MZ4 2.8 HDAC8_HUMAN
34 PsiBlast_CBE 68.7643%-128 - C2 -1T64 4.7 HDAC8_HUMAN
69 PsiBlast_CBE 68.6942%-127 - C2 -5DC5 2.5 HDAC8_HUMAN
18 PsiBlast_PDB 68.6343%-132 - C2 -5FCW 5.6 ?
90 PsiBlast_CBE 68.6242%-132 - C2 -3MZ4 3.5 HDAC8_HUMAN
84 PsiBlast_CBE 68.6042%-125 - C2 -4QA6 4.8 HDAC8_HUMAN
92 PsiBlast_CBE 68.5242%-127 - C2 -5DC7 2.2 HDAC8_HUMAN
98 PsiBlast_CBE 68.4942%-128 * C2 *4QA0 3.8 HDAC8_HUMAN
44 PsiBlast_CBE 68.4943%-130 - C2 -3MZ3 2.6 HDAC8_HUMAN
88 PsiBlast_CBE 68.3542%-132 - C2 -3MZ6 3.1 HDAC8_HUMAN
35 PsiBlast_CBE 68.2843%-130 - C2 -4QA3 4.5 HDAC8_HUMAN
86 PsiBlast_CBE 68.2642%-130 - C2 -3EW8 3.3 HDAC8_HUMAN
81 PsiBlast_CBE 68.1842%-128 - C2 -5D1B 2.4 HDAC8_HUMAN
37 PsiBlast_CBE 68.1843%-127 - C2 -3F0R 4.5 HDAC8_HUMAN
85 PsiBlast_CBE 68.1742%-124 - C2 -4QA6 5.1 HDAC8_HUMAN
96 PsiBlast_CBE 67.9842%-128 - C2 -5DC8 2.2 HDAC8_HUMAN
12 PsiBlast_PDB 67.9843%-127 - C2 -1T64 4.5 HDAC8_HUMAN
9 PsiBlast_PDB 67.9343%-129 - C2 -4QA4 4.3 HDAC8_HUMAN
41 PsiBlast_CBE 67.8443%-131 - C2 -3RQD 5.0 HDAC8_HUMAN
77 PsiBlast_CBE 67.8042%-127 - C2 -3EWF 5.2 HDAC8_HUMAN
11 PsiBlast_PDB 67.7843%-129 - C2 -3SFH 6.6 HDAC8_HUMAN
66 PsiBlast_CBE 67.7242%-133 - C2 -3EZP 3.7 HDAC8_HUMAN
93 PsiBlast_CBE 67.6942%-127 - C2 -5D1C 2.2 HDAC8_HUMAN
74 PsiBlast_CBE 67.6742%-126 - C2 -3EWF 5.0 HDAC8_HUMAN
71 PsiBlast_CBE 67.6643%-132 - C2 -4QA2 3.7 HDAC8_HUMAN
61 PsiBlast_CBE 67.6542%-132 - C2 -3EZT 3.7 HDAC8_HUMAN
60 PsiBlast_CBE 67.4842%-131 - C2 -3EZT 3.6 HDAC8_HUMAN
43 PsiBlast_CBE 67.4643%-131 - C2 -3MZ3 3.8 HDAC8_HUMAN
83 PsiBlast_CBE 67.3842%-129 - C2 -5DC6 2.2 HDAC8_HUMAN
75 PsiBlast_CBE 67.3642%-126 - C2 -3EWF 5.3 HDAC8_HUMAN
48 PsiBlast_CBE 67.2943%-130 - C2 -2V5X 5.0 HDAC8_HUMAN
70 PsiBlast_CBE 67.2543%-123 - C2 -4QA2 4.2 HDAC8_HUMAN
79 PsiBlast_CBE 67.2342%-126 - C2 -4QA5 4.6 HDAC8_HUMAN
54 PsiBlast_CBE 67.1143%-125 - C2 -4RN1 3.3 HDAC8_HUMAN
73 PsiBlast_CBE 67.0542%-133 - C2 -3F06 3.9 HDAC8_HUMAN
67 PsiBlast_CBE 67.0242%-133 - C2 -3EZP 2.6 HDAC8_HUMAN
45 PsiBlast_CBE 66.9743%-132 - C2 -5BWZ 5.0 HDAC8_HUMAN
72 PsiBlast_CBE 66.8542%-132 - C2 -3F06 3.9 HDAC8_HUMAN
82 PsiBlast_CBE 66.8342%-129 - C2 -5DC6 2.9 HDAC8_HUMAN
68 PsiBlast_CBE 66.8042%-129 - C2 -5DC5 4.8 HDAC8_HUMAN
32 PsiBlast_CBE 66.7143%-129 - C2 -1W22 4.0 HDAC8_HUMAN
57 PsiBlast_CBE 66.6743%-131 - C2 -4RN0 2.6 HDAC8_HUMAN
36 PsiBlast_CBE 66.5843%-133 - C2 -5FCW 4.6 ?
52 PsiBlast_CBE 66.5043%-128 - C2 -4RN2 3.4 HDAC8_HUMAN
46 PsiBlast_CBE 66.4643%-129 - C2 -5BWZ 4.6 HDAC8_HUMAN
53 PsiBlast_CBE 66.4043%-132 - C2 -4RN2 3.3 HDAC8_HUMAN
55 PsiBlast_CBE 65.9543%-128 - C2 -4RN1 3.3 HDAC8_HUMAN
10 PsiBlast_PDB 64.6243%-135 - C2 -3SFF 6.7 HDAC8_HUMAN