@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A0A125YPH2_TOXGG: (2017-06-15 )
MALSALRKRVAYFYDPDIGSYYYGPGHPMKPQRIRMAHALVLSYDLYKHMEVYRPHKSIEPELCLFHSSDYISFLSSVSPENYKEFSLQLKNFNVGEATDCPVFDGLFTFQQACAGASIDAAKKLNHHQADICVNWSGGLHHAKRSEASGFCYINDIVLGILELLKYHARVMYIDIDIHHGDGVEEAFYVSHRVMTVSFHKFGDFFPGTGDVTDVGASQGKYYAVNVPLNDGMDDDSFVALFKPVITKCVDVYRPGAIVLQCGADSLTGDRLGKFNLTIKGHAACVAFVKSLDIPLLVLGGGGYTIRNVARCWAYETGVVLDRHREMSPHVPLNDYYDYYAPDFQLHLTPSSIPNSNSPEHLEKIKTRVLSNLSYLEHAPGVQFAYVPPDFFGEDNDDEDEFMQNQVDNEGGGRAAGATAHTAANAPYRIRRKDYANDFEDMADRDQKVPI

Atome Classification :

(102 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IWX_C_21(5IWG)
HDAC2_HUMAN
[Raw transfer]




NHB_A_6(1W22)
HDAC8_HUMAN
[Raw transfer]




NHB_B_10(1W22)
HDAC8_HUMAN
[Raw transfer]




LLX_C_16(3MAX)
HDAC2_HUMAN
[Raw transfer]




20Y_A_10(4LY1)
HDAC2_HUMAN
[Raw transfer]




SHH_C_24(4LXZ)
HDAC2_HUMAN
[Raw transfer]




B3N_A_2(4QA4)
HDAC8_HUMAN
[Raw transfer]




TSN_B_15(1T64)
HDAC8_HUMAN
[Raw transfer]




TSN_A_13(1T64)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3MZ3)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(1T67)
HDAC8_HUMAN
[Raw transfer]




B3N_B_10(3MZ3)
HDAC8_HUMAN
[Raw transfer]




TSN_A_8(3F0R)
HDAC8_HUMAN
[Raw transfer]




TSN_C_17(3F0R)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(3F0R)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(4QA3)
HDAC8_HUMAN
[Raw transfer]




TSN_A_3(4QA3)
HDAC8_HUMAN
[Raw transfer]




V5X_A_6(2V5X)
HDAC8_HUMAN
[Raw transfer]




AGE_A_8(3F07)
HDAC8_HUMAN
[Raw transfer]




6EZ_B_17(5IX0)
HDAC2_HUMAN
[Raw transfer]




6EZ_A_7(5IX0)
HDAC2_HUMAN
[Raw transfer]




V5X_B_10(2V5X)
HDAC8_HUMAN
[Raw transfer]




5YA_B_7(5FCW)
?
[Raw transfer]




SHH_A_3(1T69)
HDAC8_HUMAN
[Raw transfer]




XCH_A_6(5BWZ)
HDAC8_HUMAN
[Raw transfer]




xxx_A_2(U162)

[Raw transfer]

-

B3N_B_11(3F06)
HDAC8_HUMAN
[Raw transfer]




B3N_B_8(5DC5)
HDAC8_HUMAN
[Raw transfer]




SHH_A_6(4QA2)
HDAC8_HUMAN
[Raw transfer]




IWX_B_13(5IWG)
HDAC2_HUMAN
[Raw transfer]




IWX_A_6(5IWG)
HDAC2_HUMAN
[Raw transfer]




SHH_A_6(4QA0)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA2)
HDAC8_HUMAN
[Raw transfer]




5YA_A_3(5FCW)
?
[Raw transfer]




LLX_A_7(3MAX)
HDAC2_HUMAN
[Raw transfer]




XCH_B_10(5BWZ)
HDAC8_HUMAN
[Raw transfer]




LLX_B_12(3MAX)
HDAC2_HUMAN
[Raw transfer]




SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




20Y_B_18(4LY1)
HDAC2_HUMAN
[Raw transfer]




0DI_A_2(3SFF)
HDAC8_HUMAN
[Raw transfer]




20Y_C_24(4LY1)
HDAC2_HUMAN
[Raw transfer]




B3N_A_5(3EW8)
HDAC8_HUMAN
[Raw transfer]




TSN_A_6(5D1B)
HDAC8_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




L7G_A_6(4RN2)
HDAC8_HUMAN
[Raw transfer]




SHH_A_10(4LXZ)
HDAC2_HUMAN
[Raw transfer]




B3N_A_5(3MZ6)
HDAC8_HUMAN
[Raw transfer]




SHH_B_18(4LXZ)
HDAC2_HUMAN
[Raw transfer]




B3N_A_4(5DC5)
HDAC8_HUMAN
[Raw transfer]




L7G_B_10(4RN2)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3MZ7)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3EZP)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZT)
HDAC8_HUMAN
[Raw transfer]




L8G_B_12(4RN1)
HDAC8_HUMAN
[Raw transfer]




L6G_B_9(4RN0)
HDAC8_HUMAN
[Raw transfer]




xxx_B_2(U164)

[Raw transfer]

-

B3N_A_6(3F06)
HDAC8_HUMAN
[Raw transfer]




xxx_B_2(U163)

[Raw transfer]

-

L8G_A_6(4RN1)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3EZT)
HDAC8_HUMAN
[Raw transfer]




L6G_A_3(4RN0)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




xxx_A_2(U161)

[Raw transfer]

-

xxx_A_2(U165)

[Raw transfer]

-

5YA_B_7(5FCW)
?
[Raw transfer]




I0P_C_17(4A69)
HDAC3_HUMAN
[Raw transfer]




20Y_A_10(4LY1)
HDAC2_HUMAN
[Raw transfer]




TSN_B_13(3F0R)
HDAC8_HUMAN
[Raw transfer]




TSN_B_16(1T64)
HDAC8_HUMAN
[Raw transfer]




AGE_B_12(3F07)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




TFG_A_8(2VQJ)

[Raw transfer]




TSN_C_18(3F0R)
HDAC8_HUMAN
[Raw transfer]




9F4_B_7(4CBT)
HDAC4_HUMAN
[Raw transfer]




OTF_A_3(5A2S)
HDAC4_HUMAN
[Raw transfer]




9F4_A_4(4CBT)
HDAC4_HUMAN
[Raw transfer]




TFG_B_12(2VQQ)

[Raw transfer]




9F4_C_10(4CBT)

[Raw transfer]




TSN_B_6(1C3R)
?
[Raw transfer]




TFG_A_7(2VQQ)
HDAC4_HUMAN
[Raw transfer]




GOL_A_7(5DC7)
HDAC8_HUMAN
[Raw transfer]




TSN_A_5(1C3R)
?
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




GOL_B_11(5D1C)
HDAC8_HUMAN
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




GOL_B_7(4QA7)
HDAC8_HUMAN
[Raw transfer]




GOL_A_7(5DC6)
HDAC8_HUMAN
[Raw transfer]




GOL_D_11(5DC6)
HDAC8_HUMAN
[Raw transfer]




OTF_B_7(5A2S)

[Raw transfer]




TSN_A_14(1T64)
HDAC8_HUMAN
[Raw transfer]




HA3_A_4(2VQM)

[Raw transfer]




GOL_D_12(5DC7)
HDAC8_HUMAN
[Raw transfer]




V5X_B_10(2V5X)
HDAC8_HUMAN
[Raw transfer]




SHH_A_3(1C3S)
?
[Raw transfer]




L6G_B_9(4RN0)
HDAC8_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




L8G_B_12(4RN1)
HDAC8_HUMAN
[Raw transfer]




B3N_B_8(5DC5)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA2)
HDAC8_HUMAN
[Raw transfer]




CHAIN_L_5(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_B_2(4QA7)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

B3N_B_10(3MZ3)
HDAC8_HUMAN
[Raw transfer]




CHAIN_L_8(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_L_5(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(4QA3)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




CHAIN_D_4(3RQD)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_L_8(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

B3N_B_11(3EZT)
HDAC8_HUMAN
[Raw transfer]




NHB_B_10(1W22)
HDAC8_HUMAN
[Raw transfer]




L7G_B_10(4RN2)
HDAC8_HUMAN
[Raw transfer]




CHAIN_D_4(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_C_3(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_J_6(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_C_3(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(3RQD)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_J_6(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

6 PsiBlast_PDB 94.6564%-120 - C2 -5IWG 8.0 HDAC2_HUMAN
30 PsiBlast_CBE 93.6064%-122 - C2 -5IX0 8.1 HDAC2_HUMAN
7 PsiBlast_PDB 93.6064%-120 - C2 -5IX0 8.2 HDAC2_HUMAN
5 PsiBlast_PDB 93.2964%-121 - C2 -3MAX 7.7 HDAC2_HUMAN
29 PsiBlast_CBE 93.1664%-124 - C2 -5IX0 - HDAC2_HUMAN
26 PsiBlast_CBE 93.0164%-122 - C2 -3MAX 7.9 HDAC2_HUMAN
27 PsiBlast_CBE 92.9664%-124 - C2 -5IWG 7.7 HDAC2_HUMAN
2 PsiBlast_PDB 92.9564%-120 - C2 -5ICN 7.4 HDAC1_HUMAN
28 PsiBlast_CBE 92.8464%-120 - C2 -5IWG 8.1 HDAC2_HUMAN
25 PsiBlast_CBE 92.7364%-120 - C2 -3MAX 7.7 HDAC2_HUMAN
22 PsiBlast_CBE 92.6763%-121 - C2 -4LY1 7.7 HDAC2_HUMAN
21 PsiBlast_CBE 92.6563%-121 - C2 -4LY1 7.7 HDAC2_HUMAN
4 PsiBlast_PDB 92.4063%-120 - C2 -4LY1 7.6 HDAC2_HUMAN
3 PsiBlast_PDB 92.0463%-120 - C2 -4LXZ 6.1 HDAC2_HUMAN
1 PsiBlast_PDB 91.9664%-119 - C2 -4BKX - HDAC1_HUMAN
24 PsiBlast_CBE 91.8163%-118 - C2 -4LXZ 6.7 HDAC2_HUMAN
23 PsiBlast_CBE 91.0463%-120 - C2 -4LXZ 5.4 HDAC2_HUMAN
136 HHSearch 90.2165%-109 - C2 -4LY1 7.8 HDAC2_HUMAN
132 HHSearch 88.9664%-107 - C2 -4BKX 6.6 HDAC1_HUMAN
8 PsiBlast_PDB 86.2759% -78 - C2 -4A69 - HDAC3_HUMAN
135 HHSearch 86.0060% -83 - C2 -4A69 8.0 HDAC3_HUMAN
152 Fugue 71.4640% -76 - C2 -4QA5 6.2 HDAC8_HUMAN
134 HHSearch 71.4539% -79 - C2 -5DC8 5.8 HDAC8_HUMAN
93 PsiBlast_CBE 70.3441% -69 - C2 -5DC7 2.2 HDAC8_HUMAN
18 PsiBlast_PDB 70.1541% -72 - C2 -1T67 4.1 HDAC8_HUMAN
68 PsiBlast_CBE 70.0541% -73 - C2 -3EZP 2.6 HDAC8_HUMAN
14 PsiBlast_PDB 69.9141% -67 - C2 -3F0R 4.5 HDAC8_HUMAN
60 PsiBlast_CBE 69.8241% -70 - C2 -4QA7 5.0 HDAC8_HUMAN
49 PsiBlast_CBE 69.7141% -70 - C2 -4RN1 3.0 HDAC8_HUMAN
17 PsiBlast_PDB 69.5441% -68 - C2 -1T64 5.1 HDAC8_HUMAN
76 PsiBlast_CBE 69.4741% -71 - C2 -5DC6 2.2 HDAC8_HUMAN
92 PsiBlast_CBE 69.2341% -70 - C2 -5DC7 2.8 HDAC8_HUMAN
71 PsiBlast_CBE 69.2041% -76 - C2 -3F06 4.1 HDAC8_HUMAN
75 PsiBlast_CBE 69.1441% -71 - C2 -5DC6 2.9 HDAC8_HUMAN
65 PsiBlast_CBE 69.1241% -71 - C2 -5DC5 4.8 HDAC8_HUMAN
67 PsiBlast_CBE 69.0641% -73 - C2 -3EZP 3.7 HDAC8_HUMAN
97 PsiBlast_CBE 69.0541% -68 - C2 -5DC8 2.2 HDAC8_HUMAN
72 PsiBlast_CBE 68.9541% -75 - C2 -3F06 4.4 HDAC8_HUMAN
44 PsiBlast_CBE 68.9541% -68 - C2 -1T64 5.3 HDAC8_HUMAN
66 PsiBlast_CBE 68.9241% -66 - C2 -5DC5 2.5 HDAC8_HUMAN
11 PsiBlast_PDB 68.8741% -68 - C2 -4QA3 4.6 HDAC8_HUMAN
12 PsiBlast_PDB 68.8341% -68 - C2 -4QA4 4.3 HDAC8_HUMAN
70 PsiBlast_CBE 68.8241% -71 - C2 -4QA2 3.8 HDAC8_HUMAN
85 PsiBlast_CBE 68.7941% -73 - C2 -3MZ4 2.4 HDAC8_HUMAN
56 PsiBlast_CBE 68.7641% -67 - C2 -2V5W 6.6 HDAC8_HUMAN
34 PsiBlast_CBE 68.7641% -69 - C2 -4QA3 4.5 HDAC8_HUMAN
88 PsiBlast_CBE 68.7041% -67 - C2 -4QA6 5.0 HDAC8_HUMAN
52 PsiBlast_CBE 68.6941% -72 - C2 -2V5X 6.0 HDAC8_HUMAN
95 PsiBlast_CBE 68.6441% -68 * C2 *4QA0 3.8 HDAC8_HUMAN
87 PsiBlast_CBE 68.5641% -70 - C2 -3EW8 3.6 HDAC8_HUMAN
94 PsiBlast_CBE 68.4941% -70 - C2 -4QA0 4.9 HDAC8_HUMAN
47 PsiBlast_CBE 68.4241% -68 - C2 -4RN2 4.2 HDAC8_HUMAN
48 PsiBlast_CBE 68.3741% -66 - C2 -4RN1 3.3 HDAC8_HUMAN
10 PsiBlast_PDB 68.3541% -69 - C2 -5BWZ 5.0 HDAC8_HUMAN
19 PsiBlast_PDB 68.3441% -70 - C2 -1T69 2.9 HDAC8_HUMAN
82 PsiBlast_CBE 68.3341% -66 - C2 -3EWF 1.7 HDAC8_HUMAN
78 PsiBlast_CBE 68.3341% -69 - C2 -5D1B 4.8 HDAC8_HUMAN
51 PsiBlast_CBE 68.2941% -71 - C2 -4RN0 3.9 HDAC8_HUMAN
42 PsiBlast_CBE 68.2841% -71 - C2 -1W22 4.1 HDAC8_HUMAN
37 PsiBlast_CBE 68.2441% -72 - C2 -3F0R 4.6 HDAC8_HUMAN
69 PsiBlast_CBE 68.2341% -67 - C2 -4QA2 3.8 HDAC8_HUMAN
86 PsiBlast_CBE 68.2141% -71 - C2 -3MZ4 3.6 HDAC8_HUMAN
77 PsiBlast_CBE 68.1941% -68 - C2 -5D1B 4.2 HDAC8_HUMAN
73 PsiBlast_CBE 68.1841% -67 - C2 -4QA5 5.2 HDAC8_HUMAN
35 PsiBlast_CBE 68.1541% -72 - C2 -3RQD 5.0 HDAC8_HUMAN
16 PsiBlast_PDB 68.1541% -72 - C2 -3RQD 4.3 HDAC8_HUMAN
81 PsiBlast_CBE 68.0841% -66 - C2 -3EWF 5.7 HDAC8_HUMAN
83 PsiBlast_CBE 67.9541% -71 - C2 -3MZ7 2.9 HDAC8_HUMAN
79 PsiBlast_CBE 67.9241% -65 - C2 -3EWF 5.2 HDAC8_HUMAN
89 PsiBlast_CBE 67.8041% -67 - C2 -4QA6 2.0 HDAC8_HUMAN
38 PsiBlast_CBE 67.7941% -65 - C2 -3F0R 4.6 HDAC8_HUMAN
80 PsiBlast_CBE 67.6641% -65 - C2 -3EWF 1.6 HDAC8_HUMAN
59 PsiBlast_CBE 67.6341% -70 - C2 -3EZT 3.7 HDAC8_HUMAN
33 PsiBlast_CBE 67.6341% -71 - C2 -5BWZ 5.0 HDAC8_HUMAN
55 PsiBlast_CBE 67.5742% -70 - C2 -5FCW 5.5 ?