@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CRK: (2018-07-12 )
MSTAGRYKHVVKLGEGTYGSVYKGTEIQTGKVVAFKRMVVTSDDEGVPGAAIREICLLKELRHDNVVDLFEVLFEPPKITMIFELCDCDLKRFMESRPKRLLDAEAEMRPILKQIFIGLEYLHSRSVVHRDMKPQNIFVNVRAPDFAALTASPSSRQDHLQPPPFSGVPTAVGGDVQSAAGSDGRPNPFAGADSVPPWEAAAAAPSNTPNQLIVKIGDFGLARVEEIPVKKYSHEVVTLWYRSPDVLMGSALYSYPVDIWSMGAIFFEMATSKVLFSGRHEDEQLLRMFWLLGSPTRETWPSMLSYPGAMERLERASRAAAERPDLRFGSEVYVQQQQQPPSSQSHSGGRAPDLLTQIAHKRFYHSLKAIQQREESARSSSNTYQLPVELWFDRPLFGEYMSATGFDSCVTAEGVNLLRQCLLYEPNHRITAAAAVRHAYLHAVSVPTAGALDVLMTSLLQTMEACHLL

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AGS_A_4(4KRC)
PHO85_YEAST
[Raw transfer]




ADP_A_9(3QHW)
CDK2_HUMAN
[Raw transfer]




919_B_6(5G6V)
CDK16_HUMAN
[Raw transfer]




ADP_A_7(2RIO)
IRE1_YEAST
[Raw transfer]




4SP_A_5(2IW8)
CDK2_HUMAN
[Raw transfer]




AMP_A_2(3GC0)
?
[Raw transfer]




SAP_A_7(2PMI)
PHO85_YEAST
[Raw transfer]




AMP_A_2(3GC0)
?
[Raw transfer]




RRC_A_5(1UNL)
CDK5_HUMAN
[Raw transfer]




ALH_A_5(1UNG)
CDK5_HUMAN
[Raw transfer]




RRC_A_5(1UNL)
CDK5_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




919_A_3(5G6V)
CDK16_HUMAN
[Raw transfer]




LZ9_A_4(5HQ0)
CDK1_HUMAN
[Raw transfer]




LZ9_A_4(4Y72)
CDK1_HUMAN
[Raw transfer]




GOL_A_3(5BYZ)
MK07_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




MPD_A_4(4YC3)
CDK1_HUMAN
[Raw transfer]




EDO_A_5(2WEL)
KCC2D_HUMAN
[Raw transfer]




MPD_A_4(4YC3)
CDK1_HUMAN
[Raw transfer]




EDO_A_8(4DN5)
M3K14_HUMAN
[Raw transfer]




25 HHSearch 83.7351%-118 * C1 *5LQF - CDK1_HUMAN -
27 HHSearch 83.6751%-117 - C1 -4YC3 2.7 CDK1_HUMAN
41 HHSearch 82.0147%-118 - C1 -1V0B - CDC2H_PLAFK -
29 HHSearch 78.2147%-120 - C1 -3QHW 6.1 CDK2_HUMAN
40 HHSearch 76.9545%-139 - C- -3GBZ - ? -
36 HHSearch 76.6545%-135 - C1 -3GC0 4.1 ?
39 HHSearch 76.0545%-122 - C1 -5G6V 12.0 CDK16_HUMAN
38 HHSearch 75.2845%-100 - C1 -5G6V 10.6 CDK16_HUMAN
31 HHSearch 75.2647%-137 - C1 -4EK4 4.3 CDK2_HUMAN
32 HHSearch 75.1848%-105 - C1 -1UNL 5.7 CDK5_HUMAN
35 HHSearch 71.5148% -98 - C1 -4AU8 2.7 CDK5_HUMAN
22 HHSearch 66.1234%-102 - C1 -1UA2 - CDK7_HUMAN -
50 Fugue 62.1923% -5 - C1 -4DN5 2.9 M3K14_HUMAN
33 HHSearch 62.0128% -54 - C1 -3EB0 - ? -
42 Fugue 61.8820% -47 - C1 -1TKI - TITIN_HUMAN -
46 Fugue 61.4621% -14 - C1 -2RIO 4.3 IRE1_YEAST
9 PsiBlast_PDB 60.6344%-128 - C1 -5LQF - CDK1_HUMAN -
5 PsiBlast_PDB 60.5548%-106 - C1 -1UNL 5.7 CDK5_HUMAN
24 HHSearch 59.9127% -65 - C1 -2WEL 3.5 KCC2D_HUMAN
8 PsiBlast_PDB 59.6044%-127 - C1 -5HQ0 5.1 CDK1_HUMAN
7 PsiBlast_PDB 59.6044%-127 - C1 -4Y72 5.1 CDK1_HUMAN
21 HHSearch 59.0032% -26 - C1 -5BYZ 3.0 MK07_HUMAN
10 PsiBlast_PDB 58.7044%-123 - C1 -4YC3 2.8 CDK1_HUMAN
1 PsiBlast_PDB 57.8248%-113 - C1 -4AU8 2.5 CDK5_HUMAN
20 PsiBlast_PDB 57.5342%-112 - C1 -2IW8 6.7 CDK2_HUMAN
3 PsiBlast_PDB 57.2548%-122 - C1 -1UNG 4.2 CDK5_HUMAN
16 PsiBlast_PDB 51.3042% -46 - C1 -4KRC 4.7 PHO85_YEAST
13 PsiBlast_PDB 48.0142%-116 - C1 -3GC0 4.1 ?
15 PsiBlast_PDB 45.6942% -79 - C1 -2PMI 3.5 PHO85_YEAST