@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : LINJ_24_1500: (2018-07-13 )
MVTTIGNGGGVVATCGQCGTAFQKLSARFCSRCGARRDIPAAAAVTAAAAARKPKPKEAVVSMPPLPSAGKESVSRPPADGAKGTLRPFDLEKLSEKRSSGGGSVAPPPLTEVSASALEFRDPSEATSITTPKRRASLATAAGGVLSSAVDASLTLSDQQRRREQRASSNYVKDGSLTGPPLASMADRDQLEHVLTSSSQEDAAMGGAAGNGVDRSHVPIPPPEQRPPSTFPLSVALVRRDGGRAAVTDGADFKGASVKTAPTAWPAEAQASTSNGGDTEEAIASLRPSAEEEAQYTAWVTLSPDDLTPEMLQTSNASELRQWRKGSLIGRGTYGSVYLGLLPDGSFHAVKCVELGNRKAAADHLGALELVSLSREVNMMHRLRHRNLCTFKGVYFDSESACVCMFMEYIGGGSLSALVKKFKPLPSSVVRSWTQQLLSGLHYLHSQHIIHRDIKGDNVLVDTTADPATKSQIKLVDFGAARRLTDAVSQSSTVIGTPYWMAPEVVDASGDGSGYSYKADVWSVGCTVAEMLTGRPPWPCKTSAPAAIMMIASATGMPTEIPEEEATPGCLDFMRQCFIRDPEKRPTVQQLLQHPWIQVKME

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATG_A_10(4DN5)
M3K14_HUMAN
[Raw transfer]




4KT_A_4(5AX9)
TNIK_HUMAN
[Raw transfer]




IE8_A_4(4BID)
M3K5_HUMAN
[Raw transfer]




STU_A_3(4BF2)
M3K5_HUMAN
[Raw transfer]




STU_A_3(2CLQ)
M3K5_HUMAN
[Raw transfer]




8GV_A_4(5UOR)
M3K5_HUMAN
[Raw transfer]




IE4_A_3(4BIC)
M3K5_HUMAN
[Raw transfer]




9E1_A_5(5VIL)
M3K5_HUMAN
[Raw transfer]




IE6_A_4(4BIE)
M3K5_HUMAN
[Raw transfer]




58C_A_4(5D7A)
TNIK_HUMAN
[Raw transfer]




IEO_A_3(4BIB)
M3K5_HUMAN
[Raw transfer]




9E4_A_5(5VIO)
M3K5_HUMAN
[Raw transfer]




8V7_A_3(5V24)
M3K5_HUMAN
[Raw transfer]




6G2_A_2(5J5T)
M4K3_HUMAN
[Raw transfer]




3D9_A_5(4U44)
M4K4_HUMAN
[Raw transfer]




3D8_A_3(4U43)
M4K4_HUMAN
[Raw transfer]




2QU_A_5(4OBP)
M4K4_HUMAN
[Raw transfer]




2QT_A_5(4OBQ)
M4K4_HUMAN
[Raw transfer]




2QV_A_5(4OBO)
M4K4_HUMAN
[Raw transfer]




49 Fugue 66.4825% -19 - C1 -2RIO - IRE1_YEAST -
47 Fugue 66.1421% -21 - C1 -1KOB - ? -
20 PsiBlast_PDB 63.6833% -24 - C1 -4U44 6.7 M4K4_HUMAN
17 PsiBlast_PDB 61.9933% -25 - C1 -4OBP 6.4 M4K4_HUMAN
24 HHSearch 61.6532% -44 - C1 -5J5T 7.0 M4K3_HUMAN
33 HHSearch 59.3027% -39 - C1 -2X0G - DAPK1_HUMAN -
26 HHSearch 59.1227% -38 - C1 -3C0I - CSKP_HUMAN -
45 Fugue 58.4725% -21 - C1 -1TKI - TITIN_HUMAN -
37 HHSearch 57.7230% -39 - C1 -4XBR - INKA1_HUMAN (first) -
19 PsiBlast_PDB 57.5333% -4 - C1 -4U43 4.5 M4K4_HUMAN
22 HHSearch 57.2327% -31 - C1 -1TKI - TITIN_HUMAN -
41 HHSearch 56.9327% -30 - C1 -4B4L - DAPK1_HUMAN -
42 HHSearch 54.9925% -10 - C1 -2PHK - PHKG1_RABIT -
12 PsiBlast_PDB 53.6332% 10 - C1 -5AX9 6.8 TNIK_HUMAN
27 HHSearch 53.1126% -11 - C1 -2Y7J - PHKG2_HUMAN -
36 HHSearch 53.0326% -54 - C1 -3I6U - CHK2_HUMAN -
25 HHSearch 53.0127% -34 - C1 -3C0G - CSKP_HUMAN -
40 HHSearch 52.9924% -53 - C1 -2BDW - KCC2D_CAEEL -
43 Fugue 52.7827% -8 - C1 -4DN5 6.0 M3K14_HUMAN
23 HHSearch 52.2626% -10 - C1 -2Y7J - PHKG2_HUMAN -
14 PsiBlast_PDB 52.2632% 8 - C1 -5D7A 7.0 TNIK_HUMAN
16 PsiBlast_PDB 50.5533% -20 - C1 -4OBO 6.1 M4K4_HUMAN
2 PsiBlast_PDB 50.5536% 6 - C1 -5VIL 6.6 M3K5_HUMAN
1 PsiBlast_PDB 49.0736% 11 - C1 -2CLQ 7.1 M3K5_HUMAN
6 PsiBlast_PDB 47.7435% 9 - C1 -4BIC 4.8 M3K5_HUMAN
8 PsiBlast_PDB 47.5035% 4 - C1 -4BIE 4.9 M3K5_HUMAN
18 PsiBlast_PDB 47.4033% -9 - C1 -4OBQ 6.9 M4K4_HUMAN
3 PsiBlast_PDB 46.1336% 11 - C1 -5VIO 5.5 M3K5_HUMAN
5 PsiBlast_PDB 45.1735% 4 - C1 -4BIB 4.7 M3K5_HUMAN
4 PsiBlast_PDB 43.8435% 5 - C1 -4BF2 6.6 M3K5_HUMAN
9 PsiBlast_PDB 43.0236% 5 - C1 -5V24 5.2 M3K5_HUMAN
7 PsiBlast_PDB 42.4135% 11 - C1 -4BID 8.7 M3K5_HUMAN
10 PsiBlast_PDB 42.0736% -5 - C1 -5UOR 6.4 M3K5_HUMAN