@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : LINJ_26_2600: (2018-07-13 )
MATPVTDPPKIIGRELHLDRLIGSGGFGEVYLAVRTKLATNPKHNFTFPAECVVKVMRRGLCTEEDVAAMNREVATLSSMDHPYIVAYIGAWVEAARGKFFGCYCLAMKYCEGGDLHGFIAQCIKAHRLPPVDVAVRIMAQVFSALNYSHSRRLIHRDIKPGNVFLTLQKSGVPDKAMVGDYGLVRSLEATRQLVKTRVGTPTYISPEIAAGEAYSTKTDIFSAGTMFYELLSLHRPFWKRMMTDQQLFREVLHRDPMPQFRAYTSSVYGTALADVIEACLTKHEANRATAYDALVRLTSPITAYVLKYAIPVYPEKDALTTSPPRPPAASSAPDGHASAADADGDAATARQRLERLFLVRKGTAVGARLTRLLSHNAELLFQVRVLVACRSDNTDHLENGLAELLWAFPDAEVPFQEVIDLVMSDYRQLAE

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EQH_A_2(2XK6)
NEK2_HUMAN
[Raw transfer]




T3M_A_2(2XKD)
NEK2_HUMAN
[Raw transfer]




VGK_A_2(2WQO)
NEK2_HUMAN
[Raw transfer]




5R1_A_2(2XK8)
NEK2_HUMAN
[Raw transfer]




30E_A_2(2XK7)
NEK2_HUMAN
[Raw transfer]




BX1_A_2(2XKF)
NEK2_HUMAN
[Raw transfer]




XK3_A_2(2XK3)
NEK2_HUMAN
[Raw transfer]




OL2_A_2(2XK4)
NEK2_HUMAN
[Raw transfer]




WI2_A_2(2XKE)
NEK2_HUMAN
[Raw transfer]




4VQ_A_2(2XKC)
NEK2_HUMAN
[Raw transfer]




WCX_A_2(2XNP)
NEK2_HUMAN
[Raw transfer]




430_A_2(2XNN)
NEK2_HUMAN
[Raw transfer]




WGZ_A_2(2XNM)
NEK2_HUMAN
[Raw transfer]




ADP_A_2(2W5A)
NEK2_HUMAN
[Raw transfer]




NU6_A_2(5M51)
NEK2_HUMAN
[Raw transfer]




ED8_A_2(2XNO)
NEK2_HUMAN
[Raw transfer]




1 PsiBlast_PDB 73.8529% -98 - C1 -2WQM - NEK7_HUMAN -
51 Fugue 73.3921% - - C1 -3QA8 - ? -
3 PsiBlast_PDB 72.6329%-100 - C1 -5DE2 - NEK7_HUMAN -
2 PsiBlast_PDB 72.1229% -97 - C1 -2WQN - NEK7_HUMAN -
23 HHSearch 70.4925%-125 - C1 -2WEL - KCC2D_HUMAN -
28 HHSearch 66.7523%-119 - C1 -2BDW - KCC2D_CAEEL -
45 Fugue 64.2821%-102 - C1 -1TKI - TITIN_HUMAN -
32 HHSearch 63.0026%-118 - C1 -4G3F - -
50 Fugue 60.5923% -75 - C1 -1BYG - CSK_HUMAN -
49 Fugue 60.2218% -18 - C1 -2RIO - IRE1_YEAST -
43 HHSearch 60.1425%-128 - C1 -1KOB - ? -
35 HHSearch 57.5619% -57 - C1 -2PSQ - -
31 HHSearch 56.8326% -90 - C1 -5J5T - M4K3_HUMAN -
46 Fugue 55.4021% 16 - C1 -1KOB - ? -
25 HHSearch 55.2123%-127 - C1 -1TKI - TITIN_HUMAN -
4 PsiBlast_PDB 53.6735%-137 - C1 -2W5A 4.5 NEK2_HUMAN
47 Fugue 53.6419% -15 - C1 -2PZI - PKNG_MYCTU -
41 HHSearch 53.3323%-107 - C1 -1J1B - GSK3B_HUMAN -
22 HHSearch 51.9725% -57 - C1 -3C0I - CSKP_HUMAN -
27 HHSearch 51.4422%-131 - C1 -2X4F - MYLK4_HUMAN -
13 PsiBlast_PDB 49.6135%-151 - C1 -2XKF 5.7 NEK2_HUMAN
12 PsiBlast_PDB 47.8435%-130 - C1 -2XKD 6.1 NEK2_HUMAN
7 PsiBlast_PDB 47.6835%-134 - C1 -2XK4 6.2 NEK2_HUMAN
9 PsiBlast_PDB 47.5235%-140 - C1 -2XK7 5.7 NEK2_HUMAN
18 PsiBlast_PDB 47.3835%-136 - C1 -2XNP 6.9 NEK2_HUMAN
8 PsiBlast_PDB 47.1635%-133 - C1 -2XK6 5.9 NEK2_HUMAN
5 PsiBlast_PDB 46.6235%-145 - C1 -2WQO 6.6 NEK2_HUMAN
17 PsiBlast_PDB 46.0735%-136 - C1 -2XNO 4.8 NEK2_HUMAN
10 PsiBlast_PDB 45.8435%-136 - C1 -2XK8 5.7 NEK2_HUMAN
19 PsiBlast_PDB 45.5235%-103 - C1 -5M51 5.5 NEK2_HUMAN
15 PsiBlast_PDB 45.5235%-132 - C1 -2XNM 6.1 NEK2_HUMAN
14 PsiBlast_PDB 45.4935%-127 - C1 -2XKE 5.6 NEK2_HUMAN
6 PsiBlast_PDB 45.1835%-133 - C1 -2XK3 6.0 NEK2_HUMAN
11 PsiBlast_PDB 44.7535%-139 - C1 -2XKC 5.8 NEK2_HUMAN
16 PsiBlast_PDB 43.2335%-126 - C1 -2XNN 4.7 NEK2_HUMAN