@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : LINJ_29_1420: (2018-07-13 )
MPSPCPSSSSPLLGSITSGIRSPSRGPVQQQQQQHQLHAPMRLRLHEDGNIRACPEKSGGGVSQACAPPLPAASAFARGKEEPSAKRHHAEPSSCPAPDGDSSSVGRSAAATAVTIAAPLLSISNPSSRAAPSPFRFLCTSLGGCPVVGAKGARVHLPGSSASCDVSGSVAPRDLSTTSAHSKAHSTAAVVRASPSSGVVSPPLSATYPSLVSASRGARVVCSHPQPASAASVPGAIIDTSAPSPVPSRPHRIHQHELRPADFRREEVLGEGSYSIVTLATHRASGLCFALKEIDRSRLRWRPLEAQLRWEINLQRTLRHPHIVRLYSYFITPDCISLVLEYCSGGTLLSRLRAAPQHRLSERQASRYTRHVAKALTHLHGLGVAHRDLKLENVLIDADGIAKLADFGWSRPVVHPLPPSKSAATTQTAGDRNDVPCSSAEHDTSNEDPTEGVAEGRRTVCGTLDYLSPEMVSGQAHSAKTDVWSLGVMLAEMLTGTPPFYTESTQQTLYAIQRLPPNLTGLRPKGRGPGLTGSGASATANVCLTLDEPVALSAGALSLIHAMLQKDPSARPTMQEVLSHAWLQKTR

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0C0_A_2(3UO4)
AURKA_HUMAN
[Raw transfer]




4RK_A_2(4ZTS)
AURKA_HUMAN
[Raw transfer]




4RJ_A_2(4ZTR)
AURKA_HUMAN
[Raw transfer]




FH5_A_2(4BYJ)
AURKA_HUMAN
[Raw transfer]




9YQ_A_2(5ONE)
AURKA_HUMAN
[Raw transfer]




0BX_A_2(3UO5)
AURKA_HUMAN
[Raw transfer]




A0H_A_2(2XNG)
AURKA_HUMAN
[Raw transfer]




626_A_3(2J4Z)
AURKA_HUMAN
[Raw transfer]




0BY_A_3(3UO6)
AURKA_HUMAN
[Raw transfer]




0BZ_A_3(3UNZ)
AURKA_HUMAN
[Raw transfer]




VEK_A_2(4B0G)
AURKA_HUMAN
[Raw transfer]




ACP_A_5(4C3P)
AURKA_HUMAN
[Raw transfer]




4QV_A_2(4ZS0)
AURKA_HUMAN
[Raw transfer]




4RM_A_2(4ZTQ)
AURKA_HUMAN
[Raw transfer]




FH3_A_2(4BYI)
AURKA_HUMAN
[Raw transfer]




ADN_B_2(1MUO)
AURKA_HUMAN
[Raw transfer]




ADN_A_2(4O0S)
AURKA_HUMAN
[Raw transfer]




GOL_A_6(4GV1)
AKT1_HUMAN
[Raw transfer]




EDO_A_3(4JXF)
PLK4_HUMAN
[Raw transfer]




DMS_A_7(5VCY)
PMYT1_HUMAN
[Raw transfer]




10 PsiBlast_PDB 74.1633%-117 - C1 -4ZS0 6.2 AURKA_HUMAN
13 PsiBlast_PDB 72.1933%-125 - C1 -4ZTS 8.7 AURKA_HUMAN
18 PsiBlast_PDB 72.1433%-112 - C1 -3UO4 7.0 AURKA_HUMAN
16 PsiBlast_PDB 70.8633%-113 - C1 -4O0S 4.2 AURKA_HUMAN
19 PsiBlast_PDB 70.6233%-113 - C1 -3UO5 6.2 AURKA_HUMAN
6 PsiBlast_PDB 70.5233%-114 - C1 -2X6D - AURKA_HUMAN -
4 PsiBlast_PDB 70.1833%-120 - C1 -2XNG 7.2 AURKA_HUMAN
15 PsiBlast_PDB 70.1133%-124 - C1 -4C3P 5.0 AURKA_HUMAN
47 Fugue 69.5035% - - C1 -3H4J - SNF1_SCHPO -
12 PsiBlast_PDB 69.3233%-123 - C1 -4ZTR 8.7 AURKA_HUMAN
11 PsiBlast_PDB 68.8733%-128 - C1 -4ZTQ 7.1 AURKA_HUMAN
8 PsiBlast_PDB 68.8633%-119 - C1 -4BYI 6.7 AURKA_HUMAN
36 HHSearch 68.8231% -55 * C1 *4GV1 2.8 AKT1_HUMAN
41 HHSearch 68.6631% -72 - C1 -3V8S - ROCK1_HUMAN -
24 HHSearch 67.2731% -78 - C1 -4WOT - ROCK2_HUMAN -
17 PsiBlast_PDB 67.1333%-113 - C1 -3UNZ 6.8 AURKA_HUMAN
9 PsiBlast_PDB 66.9433%-121 - C1 -4BYJ 6.1 AURKA_HUMAN
39 HHSearch 66.4234%-153 - C1 -4JXF 3.4 PLK4_HUMAN
14 PsiBlast_PDB 65.8733%-125 - C1 -5ONE 8.7 AURKA_HUMAN
37 HHSearch 65.5831% 0 - C- -2WEL - KCC2D_HUMAN -
20 PsiBlast_PDB 65.1833%-111 - C1 -3UO6 6.6 AURKA_HUMAN
5 PsiBlast_PDB 64.4533%-122 - C1 -4B0G 7.1 AURKA_HUMAN
2 PsiBlast_PDB 62.7333%-123 - C1 -1MUO 3.9 AURKA_HUMAN
1 PsiBlast_PDB 58.2232% 11 - C1 -2J4Z 7.2 AURKA_HUMAN