@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : LINJ_35_1030: (2018-07-13 )
MNVELRVGNRYRIGQKIGSGSFGEIFRGTNIQTGDPVAIKLEQVKTRHPQLTYESRFYRILGSGGGAVGIPMMFYHGVEGEFNVMVIELLGPSLEDLFSFCGRRLSLKTTLMLADQMISRIEFVHSKSVLHRDIKPDNFLMGTGKKGHHVYIIDFGLAKKYRDPRTHAHIPYKEGKSLTGTARYCSINTHMGVEQGRRDDMEGIGYILMYFLRGSLPWQGLKAHTKQEKYNRISERKQTTPVELLCKGFPSEFAAYMNYVRALRFEDKPDYSYLKRMFRDLFVREGYHVDYVFDWTLKRIHESLQEQQSFPGGSNGGGAAGNGSPVNQSPAQGGNGGAPNSANNQESGAQEQQ

Atome Classification :

(49 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PFO_A_3(4TN6)
KC1D_HUMAN
[Raw transfer]




0CK_B_8(3UYT)
KC1D_HUMAN
[Raw transfer]




1QM_B_8(4KBA)
KC1D_HUMAN
[Raw transfer]




1QG_B_10(4KBK)
KC1D_HUMAN
[Raw transfer]




1QM_A_5(4KBA)
KC1D_HUMAN
[Raw transfer]




9WG_C_16(5W4W)
KC1D_HUMAN
[Raw transfer]




1QO_B_8(4KB8)
KC1D_HUMAN
[Raw transfer]




ADP_B_15(5X17)
KC1D_MOUSE
[Raw transfer]




1QM_C_11(4KBA)
KC1D_HUMAN
[Raw transfer]




1QO_D_14(4KB8)
KC1D_HUMAN
[Raw transfer]




0CK_C_10(3UYT)
KC1D_HUMAN
[Raw transfer]




0CK_A_5(3UYT)
KC1D_HUMAN
[Raw transfer]




9WG_B_9(5W4W)
KC1D_HUMAN
[Raw transfer]




GOL_B_8(5X18)
KC11_YEAST
[Raw transfer]




9WG_A_5(5W4W)
KC1D_HUMAN
[Raw transfer]




ADP_A_9(5X17)
KC1D_MOUSE
[Raw transfer]




0CK_B_4(3UZP)
KC1D_HUMAN
[Raw transfer]




1QM_D_14(4KBA)
KC1D_HUMAN
[Raw transfer]




0CK_D_13(3UYT)
KC1D_HUMAN
[Raw transfer]




0CK_A_3(3UZP)
KC1D_HUMAN
[Raw transfer]




1QN_A_5(4KB8)
KC1D_HUMAN
[Raw transfer]




1QG_A_5(4KBK)
KC1D_HUMAN
[Raw transfer]




1QN_C_11(4KB8)
KC1D_HUMAN
[Raw transfer]




1QG_D_18(4KBK)
KC1D_HUMAN
[Raw transfer]




1QG_C_14(4KBK)
KC1D_HUMAN
[Raw transfer]




1QJ_A_3(4KBC)
KC1D_HUMAN
[Raw transfer]




9WG_D_21(5W4W)
KC1D_HUMAN
[Raw transfer]




15G_B_4(4HGT)
KC1D_HUMAN
[Raw transfer]




37J_B_18(4TWC)
KC1D_HUMAN
[Raw transfer]




37J_B_18(4TWC)
KC1D_HUMAN
[Raw transfer]




AUG_A_6(5IH6)
KC1D_HUMAN
[Raw transfer]




386_A_12(4TW9)
KC1D_HUMAN
[Raw transfer]




15G_A_3(4HGT)
KC1D_HUMAN
[Raw transfer]




16W_B_9(4HNI)
KC1E_HUMAN
[Raw transfer]




BRK_A_2(2IZR)
KC1G3_HUMAN
[Raw transfer]




1QJ_B_7(4KBC)
KC1D_HUMAN
[Raw transfer]




16W_A_3(4HNI)
KC1E_HUMAN
[Raw transfer]




37J_A_9(4TWC)
KC1D_HUMAN
[Raw transfer]




37J_A_9(4TWC)
KC1D_HUMAN
[Raw transfer]




DTQ_A_3(4BTK)
TTBK1_HUMAN
[Raw transfer]




386_B_20(4TW9)
KC1D_HUMAN
[Raw transfer]




16W_B_4(4HNF)
KC1D_HUMAN
[Raw transfer]




2KC_A_2(4NFN)
TTBK1_HUMAN
[Raw transfer]




16W_A_3(4HNF)
KC1D_HUMAN
[Raw transfer]




F8E_B_10(4BTM)
TTBK1_HUMAN
[Raw transfer]




ADP_A_2(4XHG)
?
[Raw transfer]




71 HHSearch 93.5271% -97 - C1 -3SV0 - ? -
63 PsiBlast_CBE 93.3168% -96 - C1 -4KBA 6.9 KC1D_HUMAN
66 PsiBlast_CBE 93.1068% -98 - C1 -4KB8 5.3 KC1D_HUMAN
1 PsiBlast_PDB 91.8365% -97 - C1 -3SV0 - ? -
5 PsiBlast_PDB 91.7768% -98 - C1 -3UYT 6.2 KC1D_HUMAN
60 PsiBlast_CBE 91.4768%-102 - C1 -4KBK 6.5 KC1D_HUMAN
10 PsiBlast_PDB 91.3769% -96 - C1 -5X17 6.3 KC1D_MOUSE
42 PsiBlast_CBE 91.0969% -97 - C1 -5X17 5.7 KC1D_MOUSE
11 PsiBlast_PDB 91.0569%-104 - C1 -4TW9 6.5 KC1D_HUMAN
12 PsiBlast_PDB 90.9769% -94 - C1 -4TWC 4.9 KC1D_HUMAN
17 PsiBlast_PDB 90.9369%-102 - C1 -4TN6 6.8 KC1D_HUMAN
56 PsiBlast_CBE 90.9268% -95 - C1 -5W4W 6.5 KC1D_HUMAN
70 HHSearch 90.8670% -94 - C1 -4TWC 5.1 KC1D_HUMAN
57 PsiBlast_CBE 90.7168%-108 - C1 -4KBK 6.0 KC1D_HUMAN
38 PsiBlast_CBE 90.4968% -99 - C1 -3UYT 7.8 KC1D_HUMAN
44 PsiBlast_CBE 90.3769%-100 - C1 -4TW9 4.3 KC1D_HUMAN
35 PsiBlast_CBE 90.3468% -99 - C1 -3UZP 5.3 KC1D_HUMAN
55 PsiBlast_CBE 90.2568% -94 - C1 -5W4W 6.5 KC1D_HUMAN
14 PsiBlast_PDB 90.0169% -96 - C1 -1CKJ - KC1D_RAT -
16 PsiBlast_PDB 89.8769% -95 - C1 -4KBC 4.8 KC1D_HUMAN
7 PsiBlast_PDB 89.7268%-101 - C1 -4HNF 5.7 KC1D_HUMAN
6 PsiBlast_PDB 89.6868% -95 - C1 -3UZP 8.0 KC1D_HUMAN
43 PsiBlast_CBE 89.6169% -90 - C1 -4TWC 7.0 KC1D_HUMAN
61 PsiBlast_CBE 89.2568%-110 - C1 -4KBA 7.2 KC1D_HUMAN
33 PsiBlast_CBE 89.1868% -93 - C1 -4HNF 6.3 KC1D_HUMAN
37 PsiBlast_CBE 89.0768% -98 - C1 -3UYT 7.2 KC1D_HUMAN
59 PsiBlast_CBE 88.9668%-100 - C1 -4KBK 6.1 KC1D_HUMAN
64 PsiBlast_CBE 88.9468%-109 - C1 -4KB8 5.3 KC1D_HUMAN
53 PsiBlast_CBE 88.8668% -95 - C1 -5W4W 6.6 KC1D_HUMAN
34 PsiBlast_CBE 88.8668%-101 - C1 -4HGT 5.3 KC1D_HUMAN
9 PsiBlast_PDB 88.8369%-102 - C1 -5IH6 5.4 KC1D_HUMAN
69 HHSearch 88.7770% -89 - C1 -4TWC 7.3 KC1D_HUMAN
58 PsiBlast_CBE 88.4668%-105 - C1 -4KBK 6.7 KC1D_HUMAN
54 PsiBlast_CBE 88.0868% -94 - C1 -5W4W 6.6 KC1D_HUMAN
8 PsiBlast_PDB 87.5268%-101 - C1 -4HGT 5.4 KC1D_HUMAN
91 Fugue 87.4553% -80 - C1 -4XHG 3.9 ?
32 PsiBlast_CBE 87.4568% -96 - C1 -4HNI 6.6 KC1E_HUMAN
2 PsiBlast_PDB 87.3568% -94 - C1 -4HNI 6.0 KC1E_HUMAN
45 PsiBlast_CBE 86.7669% -98 - C1 -4KBC 5.8 KC1D_HUMAN
62 PsiBlast_CBE 86.2568% -95 - C1 -4KBA 7.1 KC1D_HUMAN
65 PsiBlast_CBE 85.7568% -96 - C1 -4KB8 6.6 KC1D_HUMAN
36 PsiBlast_CBE 84.1468%-106 - C1 -3UYT 7.1 KC1D_HUMAN
19 PsiBlast_PDB 84.0368%-112 - C1 -4KB8 6.4 KC1D_HUMAN
20 PsiBlast_PDB 82.9568%-110 - C1 -4KBA 5.0 KC1D_HUMAN
73 HHSearch 77.6752% -56 - C1 -5X18 2.8 KC11_YEAST
68 HHSearch 77.4858% -57 - C1 -2IZR 5.0 KC1G3_HUMAN
77 HHSearch 63.0633% -29 - C1 -4BTM 5.4 TTBK1_HUMAN
76 HHSearch 62.9133% -36 - C1 -4BTK 5.4 TTBK1_HUMAN
80 HHSearch 62.1533% -34 - C1 -4NFN 7.9 TTBK1_HUMAN