@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : LINJ_35_1720: (2018-07-13 )
MSSRSSPKSPASDGAHRYAHVNVNKPSSYWDYDSLRVQWNSPDRYEVVQKIGRGKYSDVFLGVDTKVPRQVVIKVLKPVKKKKILRELMVLQTLKGGPNIVDLFDVVREPNSKTPSFVFEYVKSCDFRTVFPTFTDLEVRSYIFQVLMALEYAHSHGIMHRDVKPNNVCLDYKTGKLKLIDWGLAEFYHPATSYNARVASRYFKGPELLVELPMYDYRLDMWSLGCMLAAMIFIREPFFRGKDNTDQLVRIVKVLGTDDLQVYLKKHNASLPPVLEATLGYHAKKPWRSFVNGQNEHLCPPEALAFLDKLLQYDHMKRIQAAEAMMDPYFDPVRPKDFTLDGITVAAENGGGGASVCNEENVHEKRVPRIES

Atome Classification :

(56 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_4(1LP4)
CSK2A_MAIZE
[Raw transfer]




ANP_A_4(1DAW)
CSK2A_MAIZE
[Raw transfer]




GNP_A_4(1DAY)
CSK2A_MAIZE
[Raw transfer]




GNP_A_2(4JR7)
CSK21_YEAST
[Raw transfer]




ADP_A_4(5OSL)
?
[Raw transfer]




GNP_B_12(4LFI)
CSK21_YEAST
[Raw transfer]




HNA_A_2(1M2P)
CSK2A_MAIZE
[Raw transfer]




ATP_A_3(5CVF)
CSK21_HUMAN
[Raw transfer]




WUL_A_2(4ANM)
CSK2A_MAIZE
[Raw transfer]




LU2_A_2(4DGN)
CSK2A_MAIZE
[Raw transfer]




AGI_A_7(4DGM)
CSK2A_MAIZE
[Raw transfer]




IQA_A_2(1OM1)
CSK2A_MAIZE
[Raw transfer]




CZ0_A_2(3PWD)
CSK2A_MAIZE
[Raw transfer]




54S_A_5(5CU4)
CSK21_HUMAN
[Raw transfer]




MNX_B_2(1M2Q)
CSK2A_MAIZE
[Raw transfer]




E91_A_7(4RLK)
CSK2A_MAIZE
[Raw transfer]




E91_A_7(4RLK)
CSK2A_MAIZE
[Raw transfer]




G12_A_2(2QC6)
CSK2A_MAIZE
[Raw transfer]




YTX_A_2(5MOH)
CSK21_HUMAN
[Raw transfer]




K66_A_2(3KXH)
CSK2A_MAIZE
[Raw transfer]




K66_A_2(3KXH)
CSK2A_MAIZE
[Raw transfer]




K68_A_2(3PVG)
CSK2A_MAIZE
[Raw transfer]




BEN_A_2(1LPU)
CSK2A_MAIZE
[Raw transfer]




0JW_A_2(4DGO)
CSK2A_MAIZE
[Raw transfer]




ATP_A_2(5CU6)
CSK21_HUMAN
[Raw transfer]




54G_A_2(5CSP)
CSK21_HUMAN
[Raw transfer]




GAB_A_4(5CSV)
CSK21_HUMAN
[Raw transfer]




BEN_A_2(1LR4)
CSK2A_MAIZE
[Raw transfer]




K74_A_2(3KXM)
CSK2A_MAIZE
[Raw transfer]




ATP_A_8(5OS8)
?
[Raw transfer]




ATP_A_7(5OTR)
?
[Raw transfer]




NIO_A_2(3WAR)
CSK21_HUMAN
[Raw transfer]




BEN_A_2(1LR4)
CSK2A_MAIZE
[Raw transfer]




B5E_A_4(6EHU)
?
[Raw transfer]




EMO_A_2(3PZH)
CSK2A_MAIZE
[Raw transfer]




HBD_A_3(5MOT)
CSK21_HUMAN
[Raw transfer]




TBS_A_3(1J91)
CSK2A_MAIZE
[Raw transfer]




K25_A_3(1ZOE)
CSK2A_MAIZE
[Raw transfer]




TBS_B_4(1J91)
CSK2A_MAIZE
[Raw transfer]




MNY_B_2(1M2R)
CSK2A_MAIZE
[Raw transfer]




K6X_A_2(3KXG)
CSK2A_MAIZE
[Raw transfer]




AOK_A_5(5OTI)
?
[Raw transfer]




EMO_B_2(1F0Q)
CSK2A_MAIZE
[Raw transfer]




K17_A_3(2OXY)
CSK2A_MAIZE
[Raw transfer]




AHK_A_4(5OSZ)
?
[Raw transfer]




K17_B_4(2OXY)
CSK2A_MAIZE
[Raw transfer]




K44_A_5(1ZOH)
CSK2A_MAIZE
[Raw transfer]




B4Q_A_2(5OYF)
?
[Raw transfer]




K32_A_2(2OXD)
CSK2A_MAIZE
[Raw transfer]




K37_A_2(1ZOG)
CSK2A_MAIZE
[Raw transfer]




AUW_A_4(6EHK)
?
[Raw transfer]




AUW_A_6(5OTY)
?
[Raw transfer]




AUH_A_4(5OTQ)
?
[Raw transfer]




EDO_A_6(1ZOH)
CSK2A_MAIZE
[Raw transfer]




AUT_A_5(5OTZ)
?
[Raw transfer]




K8X_A_2(3KXN)
CSK2A_MAIZE
[Raw transfer]




AWE_A_9(5OUL)
?
[Raw transfer]




28 PsiBlast_CBE 96.3861%-134 - C1 -1ZOH 5.5 CSK2A_MAIZE
54 PsiBlast_CBE 95.8861%-133 - C1 -3PVG 5.6 CSK2A_MAIZE
21 PsiBlast_CBE 95.7961%-126 - C1 -4ANM 6.4 CSK2A_MAIZE
32 PsiBlast_CBE 95.7761%-132 - C1 -1LR4 3.2 CSK2A_MAIZE
23 PsiBlast_CBE 95.7561%-134 - C1 -3PWD 5.2 CSK2A_MAIZE
56 PsiBlast_CBE 95.5161%-132 - C1 -3KXG 5.3 CSK2A_MAIZE
53 PsiBlast_CBE 95.4761%-130 - C1 -2QC6 6.0 CSK2A_MAIZE
24 PsiBlast_CBE 95.4061%-137 - C1 -2OXY 4.9 CSK2A_MAIZE
43 PsiBlast_CBE 95.2561%-136 - C1 -3KXN 5.0 CSK2A_MAIZE
25 PsiBlast_CBE 95.2161%-138 - C1 -2OXY 5.2 CSK2A_MAIZE
35 PsiBlast_CBE 95.0861%-130 - C1 -1J91 5.4 CSK2A_MAIZE
31 PsiBlast_CBE 95.0561%-132 - C1 -1OM1 5.8 CSK2A_MAIZE
58 HHSearch 94.8562%-141 - C1 -3KXH 6.3 CSK2A_MAIZE
59 HHSearch 94.8462%-130 - C1 -4RLK 6.7 CSK2A_MAIZE
48 PsiBlast_CBE 94.8261%-132 - C1 -1DAW 5.7 CSK2A_MAIZE
51 PsiBlast_CBE 94.7761%-132 - C1 -3PZH 5.3 CSK2A_MAIZE
22 PsiBlast_CBE 94.6361%-129 - C1 -4RLK 6.7 CSK2A_MAIZE
33 PsiBlast_CBE 94.5561%-133 - C1 -1LPU 3.0 CSK2A_MAIZE
57 PsiBlast_CBE 94.4161%-129 - C1 -4DGN 5.4 CSK2A_MAIZE
55 PsiBlast_CBE 94.4061%-139 - C1 -3KXH 6.3 CSK2A_MAIZE
30 PsiBlast_CBE 94.3861%-133 - C1 -1ZOE 5.8 CSK2A_MAIZE
36 PsiBlast_CBE 94.3161%-135 - C1 -1J91 5.1 CSK2A_MAIZE
49 PsiBlast_CBE 94.0061%-130 - C1 -4DGO 5.3 CSK2A_MAIZE
34 PsiBlast_CBE 93.8461%-132 - C1 -1LP4 6.5 CSK2A_MAIZE
45 PsiBlast_CBE 93.7861%-131 - C1 -1M2R 4.5 CSK2A_MAIZE
44 PsiBlast_CBE 93.7061%-128 - C1 -3KXM 6.1 CSK2A_MAIZE
50 PsiBlast_CBE 93.6961%-130 - C1 -1M2P 5.8 CSK2A_MAIZE
27 PsiBlast_CBE 93.5361%-129 - C1 -2OXD 4.9 CSK2A_MAIZE
46 PsiBlast_CBE 93.4461%-132 - C1 -1M2Q 5.8 CSK2A_MAIZE
42 PsiBlast_CBE 93.1161%-129 - C1 -4DGM 5.9 CSK2A_MAIZE
37 PsiBlast_CBE 92.8461%-126 - C1 -1F0Q 5.5 CSK2A_MAIZE
47 PsiBlast_CBE 92.6761%-133 - C1 -1DAY 4.5 CSK2A_MAIZE
5 PsiBlast_PDB 92.3357%-134 - C1 -5OTQ 7.0 ?
10 PsiBlast_PDB 92.0157%-130 - C1 -5OYF 8.2 ?
2 PsiBlast_PDB 91.7257%-128 - C1 -5OSL 5.4 ?
29 PsiBlast_CBE 91.6761%-124 - C1 -1ZOG 5.7 CSK2A_MAIZE
15 PsiBlast_PDB 91.3657%-132 - C1 -5CU4 9.3 CSK21_HUMAN
20 PsiBlast_PDB 91.2557%-131 - C1 -5OS8 3.5 ?
11 PsiBlast_PDB 91.0557%-130 - C1 -6EHK 8.6 ?
3 PsiBlast_PDB 90.9457%-128 - C1 -5OSZ 8.6 ?
16 PsiBlast_PDB 90.9057%-129 - C1 -5CU6 3.7 CSK21_HUMAN
9 PsiBlast_PDB 90.6557%-128 - C1 -5OUL 2.9 ?
61 HHSearch 90.4658%-134 - C1 -3WAR 3.7 CSK21_HUMAN
18 PsiBlast_PDB 90.4257%-129 - C1 -5MOH 4.4 CSK21_HUMAN
14 PsiBlast_PDB 90.3457%-127 - C1 -5CSV 3.7 CSK21_HUMAN
4 PsiBlast_PDB 90.1357%-126 - C1 -5OTI 8.8 ?
12 PsiBlast_PDB 89.9457%-129 - C1 -6EHU 7.9 ?
13 PsiBlast_PDB 89.9157%-127 - C1 -5CSP 4.2 CSK21_HUMAN
7 PsiBlast_PDB 89.6657%-129 - C1 -5OTY 8.5 ?
8 PsiBlast_PDB 89.5357%-131 - C1 -5OTZ 6.5 ?
6 PsiBlast_PDB 89.5357%-126 - C1 -5OTR 3.7 ?
17 PsiBlast_PDB 88.5157%-131 - C1 -5CVF 4.8 CSK21_HUMAN
19 PsiBlast_PDB 88.3857%-124 - C1 -5MOT 2.6 CSK21_HUMAN
63 HHSearch 76.3954% -11 - C1 -4JR7 4.7 CSK21_YEAST
62 HHSearch 76.1054% -5 - C1 -4LFI 7.7 CSK21_YEAST
80 Fugue 67.6255% -16 - C1 -1LR4 3.2 CSK2A_MAIZE