@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : LINJ_35_4010: (2018-07-13 )
MLVSVGPKPEVAGTAQVPLGPTRTNVHGASPIIAASSRSAHAMSPGTWSSSLKPKVECNVTKPDTSSWKLSDFELKNTLGTGSFGRVRIAHRKGTEEYYAIKCLRKREIIKMKQQQHVAQEKGILMELCHPFIVNMMCSFQDEKKVYFVLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSLDVIYRDLKPENLLLDNKGHAKVTDFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDGRARDLVKGLLQTDHTKRLGTLKGGPADVKSHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPALTSAQQAEFKEF

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_3(4WB8)
KAPCA_HUMAN
[Raw transfer]




ADP_E_6(1RDQ)
KAPCA_MOUSE
[Raw transfer]




ANP_A_7(1CDK)
KAPCA_PIG
[Raw transfer]




ATP_E_5(3FJQ)
KAPCA_MOUSE
[Raw transfer]




ANP_E_3(4DG3)
KAPCA_MOUSE
[Raw transfer]




ANP_A_5(3IDC)
KAPCA_MOUSE
[Raw transfer]




ANP_A_4(2R5T)
SGK1_HUMAN
[Raw transfer]




ANP_A_5(3IDB)
KAPCA_MOUSE
[Raw transfer]




2PY_C_3(2OH0)
KAPCA_BOVIN
[Raw transfer]




4PY_C_3(2OJF)
KAPCA_BOVIN
[Raw transfer]




2EA_C_3(2F7E)
KAPCA_BOVIN
[Raw transfer]




4EA_C_3(2F7X)
KAPCA_BOVIN
[Raw transfer]




SMY_A_3(3OW3)
KAPCA_MOUSE
[Raw transfer]




SS5_A_3(2UZV)
KAPCA_BOVIN
[Raw transfer]




ADN_C_3(1FMO)
KAPCA_MOUSE
[Raw transfer]




0XZ_A_2(4GV1)
AKT1_HUMAN
[Raw transfer]




BD2_B_2(1RE8)
KAPCA_MOUSE
[Raw transfer]




6EA_C_3(2F7Z)
KAPCA_BOVIN
[Raw transfer]




B8L_B_2(1REK)
KAPCA_MOUSE
[Raw transfer]




B1L_B_2(1REJ)
KAPCA_MOUSE
[Raw transfer]




07U_A_2(3TXO)
KPCL_HUMAN
[Raw transfer]




5VS_A_3(5F9E)
KPCT_HUMAN
[Raw transfer]




MMG_A_2(3HDM)
SGK1_HUMAN
[Raw transfer]




3L0_A_3(4RA5)
KPCT_HUMAN
[Raw transfer]




9 PsiBlast_PDB 90.3048% -84 - C1 -4DG3 8.1 KAPCA_MOUSE
10 PsiBlast_PDB 89.9948% -87 - C1 -1FMO 5.8 KAPCA_MOUSE
17 PsiBlast_PDB 88.9548% -81 - C1 -3IDB 7.6 KAPCA_MOUSE
11 PsiBlast_PDB 88.9548% -89 - C1 -1JLU - KAPCA_MOUSE -
20 PsiBlast_PDB 88.6348% -88 - C1 -3OW3 5.6 KAPCA_MOUSE
8 PsiBlast_PDB 88.5748% -87 - C1 -2OJF 6.8 KAPCA_BOVIN
18 PsiBlast_PDB 88.5648% -80 - C1 -3IDC 6.8 KAPCA_MOUSE
12 PsiBlast_PDB 88.5248% -84 - C1 -1RE8 8.8 KAPCA_MOUSE
7 PsiBlast_PDB 88.3748% -89 - C1 -2OH0 7.0 KAPCA_BOVIN
13 PsiBlast_PDB 88.3348% -89 - C1 -1REJ 6.9 KAPCA_MOUSE
6 PsiBlast_PDB 88.3048% -92 - C1 -2F7Z 7.6 KAPCA_BOVIN
14 PsiBlast_PDB 87.5948% -90 - C1 -1REK 10.5 KAPCA_MOUSE
5 PsiBlast_PDB 87.4748% -82 - C1 -2F7X 7.2 KAPCA_BOVIN
16 PsiBlast_PDB 87.4248% -87 - C1 -3FJQ 9.5 KAPCA_MOUSE
4 PsiBlast_PDB 87.3148% -87 - C1 -2F7E 7.3 KAPCA_BOVIN
19 PsiBlast_PDB 84.3748% -88 - C1 -3O7L - KAPCA_MOUSE -
22 HHSearch 83.5354% -94 - C1 -4WIH - KAPCA_CRIGR -
25 HHSearch 82.8754% -97 - C1 -4WB8 9.5 KAPCA_HUMAN
26 HHSearch 82.7353% -98 - C1 -1RDQ 8.4 KAPCA_MOUSE
33 HHSearch 79.9354% -93 - C1 -2UZV 7.3 KAPCA_BOVIN
35 HHSearch 66.0437% -28 - C1 -5F9E 7.7 KPCT_HUMAN
49 Fugue 63.1249% -0 - C1 -1CDK 8.7 KAPCA_PIG
23 HHSearch 62.9340% -38 - C1 -4GV1 7.8 AKT1_HUMAN
27 HHSearch 62.6737% -29 * C1 *4RA5 5.1 KPCT_HUMAN
42 HHSearch 61.1144% -70 - C1 -2R5T 5.4 SGK1_HUMAN
31 HHSearch 59.4840% -45 - C1 -3TXO 6.0 KPCL_HUMAN
41 HHSearch 56.2244% -58 - C1 -3HDM 7.1 SGK1_HUMAN