@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : LINJ_35_4060: (2018-07-13 )
MSSAAKDSCPAESSGHLNNEKAQLSKIPSSHPDPSKVAVASKVKAAYSFERPDTSSWKLSDFELKNTLGTGSFGRVRIAHRKGTEEYYAIKCLRKREIIKMKQQQHVAQEKGILMELCHPFIVNMMCSFQDEKKVYFVLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSLDVIYRDLKPENLLLDNKGHAKVTDFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDGRARDLVKGLLQTDHTKRLGTLKGGPADVKSHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPALTSAQQAEFNGF

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2PY_C_3(2OH0)
KAPCA_BOVIN
[Raw transfer]




ANP_A_7(1CDK)
KAPCA_PIG
[Raw transfer]




ADP_E_6(1RDQ)
KAPCA_MOUSE
[Raw transfer]




ATP_A_3(4WB8)
KAPCA_HUMAN
[Raw transfer]




2EA_C_3(2F7E)
KAPCA_BOVIN
[Raw transfer]




IQP_A_3(5LCU)
KAPCA_CRIGR
[Raw transfer]




4PY_C_3(2OJF)
KAPCA_BOVIN
[Raw transfer]




SS5_A_3(2UZV)
KAPCA_BOVIN
[Raw transfer]




4EA_C_3(2F7X)
KAPCA_BOVIN
[Raw transfer]




ANP_A_4(2R5T)
SGK1_HUMAN
[Raw transfer]




6EA_C_3(2F7Z)
KAPCA_BOVIN
[Raw transfer]




M77_A_3(5LCP)
KAPCA_CRIGR
[Raw transfer]




6TY_A_3(5LCT)
KAPCA_CRIGR
[Raw transfer]




07U_A_2(3TXO)

[Raw transfer]




6TX_A_3(5LCR)
KAPCA_CRIGR
[Raw transfer]




5VS_A_3(5F9E)
KPCT_HUMAN
[Raw transfer]




6TV_A_3(5LCQ)
KAPCA_CRIGR
[Raw transfer]




0XZ_A_2(4GV1)
AKT1_HUMAN
[Raw transfer]




47V_A_3(5N1L)
?
[Raw transfer]




3L0_A_3(4RA5)
KPCT_HUMAN
[Raw transfer]




8FZ_A_5(5N1D)
?
[Raw transfer]




8ET_A_4(5N1F)
?
[Raw transfer]




MMG_A_2(3HDM)
SGK1_HUMAN
[Raw transfer]




9NT_A_4(5N1E)
?
[Raw transfer]




8G2_A_4(5N1H)
?
[Raw transfer]




7N9_A_4(5MHI)
KAPCA_CRIGR
[Raw transfer]




8K5_A_3(5N32)
?
[Raw transfer]




MRD_A_2(5N1G)
?
[Raw transfer]




8 PsiBlast_PDB 92.0249% -94 - C1 -5LCU 5.6 KAPCA_CRIGR
7 PsiBlast_PDB 91.4549% -92 - C1 -5LCT 5.6 KAPCA_CRIGR
4 PsiBlast_PDB 91.1949% -92 - C1 -5LCP 6.2 KAPCA_CRIGR
5 PsiBlast_PDB 89.8749% -89 - C1 -5LCQ 5.9 KAPCA_CRIGR
10 PsiBlast_PDB 89.7249% -93 - C1 -5N1D 4.9 ?
6 PsiBlast_PDB 89.4149% -88 - C1 -5LCR 5.6 KAPCA_CRIGR
2 PsiBlast_PDB 89.0249% -89 - C1 -4WIH - KAPCA_CRIGR -
20 PsiBlast_PDB 87.9349% -88 - C1 -5N1L 5.9 ?
19 PsiBlast_PDB 87.8049% -92 - C1 -5N1H 4.6 ?
17 PsiBlast_PDB 87.3849% -92 - C1 -5N1F 4.9 ?
16 PsiBlast_PDB 87.2853% -96 - C1 -2OJF 6.8 KAPCA_BOVIN
3 PsiBlast_PDB 87.1649% -89 - C1 -5MHI 3.7 KAPCA_CRIGR
18 PsiBlast_PDB 87.1149% -87 - C1 -5N1G 3.0 ?
14 PsiBlast_PDB 87.0153%-102 - C1 -2F7Z 7.6 KAPCA_BOVIN
9 PsiBlast_PDB 86.6749% -88 - C1 -5N1E 4.0 ?
15 PsiBlast_PDB 86.4553% -99 - C1 -2OH0 7.0 KAPCA_BOVIN
13 PsiBlast_PDB 86.4353% -92 - C1 -2F7X 7.2 KAPCA_BOVIN
12 PsiBlast_PDB 86.2753% -96 - C1 -2F7E 7.3 KAPCA_BOVIN
11 PsiBlast_PDB 85.5949% -93 - C1 -5N32 5.1 ?
24 HHSearch 85.3754% -97 - C1 -4WB8 9.5 KAPCA_HUMAN
28 HHSearch 84.2153% -98 - C1 -1RDQ 8.4 KAPCA_MOUSE
33 HHSearch 82.0454% -91 - C1 -2UZV 7.3 KAPCA_BOVIN
50 Fugue 67.4249% 6 - C1 -1CDK 8.7 KAPCA_PIG
34 HHSearch 66.3638% -29 - C1 -5F9E 7.7 KPCT_HUMAN
22 HHSearch 65.9341% -39 - C1 -4GV1 7.8 AKT1_HUMAN
25 HHSearch 65.2737% -32 - C1 -4RA5 5.1 KPCT_HUMAN
47 HHSearch 63.2744% -74 - C1 -2R5T 5.4 SGK1_HUMAN
29 HHSearch 61.5440% -51 - C1 -3TXO 5.6
46 HHSearch 60.1044% -62 - C1 -3HDM 7.1 SGK1_HUMAN