@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : LMAIRK: (2018-07-13 )
MTTEVGPDDNVVNSFIITPPSPKSEWTIHDFELLHKLGGGNYGDVYLASVRKSNYVVAIKKLSIKKLAEFDIVNQLRREIEIAFNTRHKYLLRTYAYFFDEHDIYLILEPCSNGMLYSELNRVKMFPPPTAARYVAQLAEALLYLHQHHILHRDIKPENILLDHNQNIKLADFGWSVHDPLNRRKTSCGTPEYFPPEIVSRQIYDMSADLWCLGIFCFELLVGHTPFVSKDNDQIYKKIHAMQYTIPDSVPPEAKDLISNLLIREGSKRLALHRVLSHPFLLKYYYVPNGITPPTGKRPRS

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_2(5ORV)
AURKA_HUMAN
[Raw transfer]




AK3_A_2(3D2I)
AURKA_MOUSE
[Raw transfer]




AK1_A_2(3D14)
AURKA_MOUSE
[Raw transfer]




AK7_A_2(3DJ7)
AURKA_MOUSE
[Raw transfer]




AK6_A_2(3DJ6)
AURKA_MOUSE
[Raw transfer]




AK2_A_2(3D15)
AURKA_MOUSE
[Raw transfer]




YJA_A_5(4C2V)
AUKBA_XENLA
[Raw transfer]




4RJ_A_2(4ZTR)
AURKA_HUMAN
[Raw transfer]




FH5_A_2(4BYJ)
AURKA_HUMAN
[Raw transfer]




9YQ_A_2(5ONE)
AURKA_HUMAN
[Raw transfer]




ACP_A_5(4C3P)
AURKA_HUMAN
[Raw transfer]




4RK_A_2(4ZTS)
AURKA_HUMAN
[Raw transfer]




FH3_A_2(4BYI)
AURKA_HUMAN
[Raw transfer]




4RM_A_2(4ZTQ)
AURKA_HUMAN
[Raw transfer]




A0H_A_2(2XNG)
AURKA_HUMAN
[Raw transfer]




ZZL_A_2(2WTW)
AURKA_HUMAN
[Raw transfer]




ADP_A_3(5L8L)
AURKA_HUMAN
[Raw transfer]




AK5_A_2(3DJ5)
AURKA_MOUSE
[Raw transfer]




626_A_3(2J4Z)
AURKA_HUMAN
[Raw transfer]




97B_A_4(3H10)
AURKA_HUMAN
[Raw transfer]




4QV_A_2(4ZS0)
AURKA_HUMAN
[Raw transfer]




YM4_A_2(2X6E)
AURKA_HUMAN
[Raw transfer]




X6D_A_4(2X6D)
AURKA_HUMAN
[Raw transfer]




ADN_A_2(4O0S)
AURKA_HUMAN
[Raw transfer]




GOL_A_6(4GV1)
AKT1_HUMAN
[Raw transfer]




10 PsiBlast_PDB 91.1244%-140 - C1 -4O0S 3.7 AURKA_HUMAN
8 PsiBlast_PDB 91.0244%-143 - C1 -2J4Z 6.8 AURKA_HUMAN
23 HHSearch 90.9142%-132 - C1 -5L8L 6.5 AURKA_HUMAN
26 HHSearch 90.6841%-137 - C1 -4C2V 8.5 AUKBA_XENLA
4 PsiBlast_PDB 90.5944%-150 - C1 -3DJ7 8.7 AURKA_MOUSE
1 PsiBlast_PDB 90.5944%-146 - C1 -3D14 8.2 AURKA_MOUSE
22 HHSearch 90.1343%-138 * C1 *5ORV 6.6 AURKA_HUMAN
2 PsiBlast_PDB 90.1244%-181 - C1 -3DJ5 9.4 AURKA_MOUSE
5 PsiBlast_PDB 90.0744%-155 - C1 -3D15 8.7 AURKA_MOUSE
6 PsiBlast_PDB 89.3544%-153 - C1 -3D2I 8.5 AURKA_MOUSE
3 PsiBlast_PDB 89.2644%-178 - C1 -3DJ6 10.2 AURKA_MOUSE
20 PsiBlast_PDB 89.1644%-146 - C1 -2XNG 6.0 AURKA_HUMAN
15 PsiBlast_PDB 88.9344%-147 - C1 -4ZS0 6.2 AURKA_HUMAN
21 HHSearch 88.7243%-130 - C1 -3H10 8.9 AURKA_HUMAN
9 PsiBlast_PDB 88.7244%-153 - C1 -4C3P 5.1 AURKA_HUMAN
13 PsiBlast_PDB 87.9144%-145 - C1 -4BYI 5.7 AURKA_HUMAN
7 PsiBlast_PDB 87.7344%-148 - C1 -2WTW 7.8 AURKA_HUMAN
17 PsiBlast_PDB 87.4244%-152 - C1 -4ZTR 7.9 AURKA_HUMAN
18 PsiBlast_PDB 87.2844%-154 - C1 -4ZTS 8.7 AURKA_HUMAN
19 PsiBlast_PDB 86.5844%-151 - C1 -5ONE 8.8 AURKA_HUMAN
16 PsiBlast_PDB 86.2844%-158 - C1 -4ZTQ 7.1 AURKA_HUMAN
14 PsiBlast_PDB 84.5544%-151 - C1 -4BYJ 6.0 AURKA_HUMAN
11 PsiBlast_PDB 84.1544%-142 - C1 -2X6D 8.6 AURKA_HUMAN
12 PsiBlast_PDB 80.2344%-148 - C1 -2X6E 7.1 AURKA_HUMAN
24 HHSearch 70.9631% -53 - C1 -4GV1 2.6 AKT1_HUMAN