@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : LEG7_HUMAN: (2018-10-05 )
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FUC_B_6(5DUX)
LEG4_HUMAN
[Raw transfer]




FMT_D_9(5DUX)
LEG4_HUMAN
[Raw transfer]




5GO_A_5(5DUW)
LEG4_HUMAN
[Raw transfer]




LAT_B_5(5DUX)
LEG4_HUMAN
[Raw transfer]




4S0_A_7(4UW5)
LEG7_HUMAN
[Raw transfer]




5GO_A_5(5DUW)
LEG4_HUMAN
[Raw transfer]




1GN_C_3(3GAL)
LEG7_HUMAN
[Raw transfer]




1GN_C_3(3GAL)
LEG7_HUMAN
[Raw transfer]




LBT_A_2(4WVV)
?
[Raw transfer]




LAT_A_5(5DUV)
LEG4_HUMAN
[Raw transfer]




LAT_A_2(3ZSJ)
LEG3_HUMAN
[Raw transfer]




LSE_B_6(3WLU)
LEG9_HUMAN
[Raw transfer]




50G_A_3(4UW3)
LEG7_HUMAN
[Raw transfer]




GAL_C_3(2GAL)
LEG7_HUMAN
[Raw transfer]




PGZ_A_3(3ZXE)
LEG7_HUMAN
[Raw transfer]




LBT_A_2(3I8T)
LEG4_MOUSE
[Raw transfer]




GOL_A_4(3I8T)
LEG4_MOUSE
[Raw transfer]




GOL_A_4(4GXL)
LEG8_HUMAN
[Raw transfer]




GOL_A_5(5DUU)
LEG4_HUMAN
[Raw transfer]




6S2_A_4(4Y26)
LEG7_HUMAN
[Raw transfer]




NAG_A_4(4XBQ)
LEG7_HUMAN
[Raw transfer]




5 PsiBlast_PDB 93.86100%-122 - C3 -4XBQ 3.8 LEG7_HUMAN
4 PsiBlast_PDB 92.79100%-111 - C3 -4UW6 - LEG7_HUMAN -
1 PsiBlast_PDB 92.63100%-113 - C3 -4UW3 4.1 LEG7_HUMAN
11 PsiBlast_PDB 92.61100%-122 - C3 -2GAL 2.4 LEG7_HUMAN
7 PsiBlast_PDB 92.59100%-121 - C3 -5H9S - LEG7_HUMAN -
2 PsiBlast_PDB 92.59100%-110 - C3 -4UW4 - LEG7_HUMAN -
8 PsiBlast_PDB 92.44100%-108 - C3 -3GAL 3.0 LEG7_HUMAN
14 PsiBlast_PDB 92.38100%-107 - C3 -3ZXE 4.2 LEG7_HUMAN
13 PsiBlast_PDB 92.32100%-117 - C3 -4Y26 3.1 LEG7_HUMAN
3 PsiBlast_PDB 92.24100%-119 - C3 -4UW5 3.1 LEG7_HUMAN
38 HHSearch 92.09100%-119 - C3 -5GAL - LEG7_HUMAN -
10 PsiBlast_PDB 91.88100%-119 - C3 -5GAL - LEG7_HUMAN -
12 PsiBlast_PDB 91.47100%-108 - C3 -1BKZ - LEG7_HUMAN -
9 PsiBlast_PDB 91.33100%-106 - C3 -4GAL - LEG7_HUMAN -
6 PsiBlast_PDB 91.01100%-113 - C3 -5H9Q - LEG7_HUMAN -
21 Fugue 86.33100% -22 - C3 -3GAL 3.0 LEG7_HUMAN
55 HHSearch 67.4841% -60 - C3 -5JP5 - LEG5_RAT -
49 HHSearch 66.7738% -71 - C3 -3NV1 - -
39 HHSearch 65.4139% -32 * C3 *5DUW 3.8 LEG4_HUMAN
17 PsiBlast_PDB 65.2538% -38 - C3 -5DUU 2.9 LEG4_HUMAN
19 PsiBlast_PDB 64.8738% -36 - C3 -5DUW 3.8 LEG4_HUMAN
20 PsiBlast_PDB 64.7438% -35 - C3 -5DUX 3.1 LEG4_HUMAN
51 HHSearch 63.4737% -38 - C3 -4GXL 3.1 LEG8_HUMAN
18 PsiBlast_PDB 63.2738% -36 - C3 -5DUV 4.1 LEG4_HUMAN
15 PsiBlast_PDB 63.2137% -35 - C3 -3I8T 4.0 LEG4_MOUSE
46 HHSearch 61.4336% -24 - C3 -3WLU 4.2 LEG9_HUMAN
53 HHSearch 60.3137% -3 - C3 -3ZSJ 3.8 LEG3_HUMAN