@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : TBB2A_HUMAN: (2018-10-06 )
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GTP_D_7(5EIB)
TBB2B_BOVIN
[Raw transfer]




GDP_B_7(3J8Y)
?
[Raw transfer]




GTP_A_7(5ND4)
TBA1B_BOVIN
[Raw transfer]




GDP_B_5(3J8X)
?
[Raw transfer]




GDP_A_3(3CB2)
TBG1_HUMAN
[Raw transfer]




GDP_B_4(1TUB)
TBB_PIG
[Raw transfer]




2 PsiBlast_PDB 94.3199% -85 - C2 -4HNA - ? -
5 PsiBlast_PDB 93.3699% -84 - C2 -5EIB 8.9 TBB2B_BOVIN
1 PsiBlast_PDB 93.1599% -80 - C2 -4F61 - ? -
18 PsiBlast_PDB 93.0999% -81 - C2 -5KX5 - ? -
17 PsiBlast_PDB 92.8999% -89 - C2 -4X20 - ? -
16 PsiBlast_PDB 92.8999% -87 - C2 -4X1Y - ? -
3 PsiBlast_PDB 92.8299% -83 - C2 -3J8X 7.4 ?
20 PsiBlast_PDB 92.7499% -88 - C2 -4I4T - TBB2B_BOVIN -
38 HHSearch 92.70100% -84 - C2 -5IYZ - TBB2B_BOVIN -
14 PsiBlast_PDB 92.6999% -90 - C2 -4X1I - ? -
15 PsiBlast_PDB 92.2499% -91 - C2 -4X1K - ? -
4 PsiBlast_PDB 91.9599% -77 - C2 -3J8Y 7.1 ?
13 PsiBlast_PDB 89.9899% -83 - C2 -3N2K - ? -
12 PsiBlast_PDB 89.7599% -85 - C2 -3N2G - ? -
10 PsiBlast_PDB 89.3699% -79 - C2 -3HKD - ? -
19 PsiBlast_PDB 89.0399% -83 - C2 -1Z2B - TBB2B_BOVIN -
40 HHSearch 88.9097% -82 - C2 -5N5N - TBB5_HUMAN -
8 PsiBlast_PDB 88.3499% -81 - C2 -3HKB - ? -
11 PsiBlast_PDB 87.4999% -83 - C2 -3HKE - ? -
6 PsiBlast_PDB 87.3199% -80 - C2 -3DU7 - TBB2B_BOVIN -
47 HHSearch 72.4442% -83 - C2 -5ND4 6.3 TBA1B_BOVIN
21 Fugue 70.8899% 4 - C2 -1TUB 4.5 TBB_PIG
41 HHSearch 58.7834% -1 - C2 -3CB2 9.0 TBG1_HUMAN