@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : TBB3_HUMAN: (2018-10-06 )
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GTP_A_7(5ND4)
TBA1B_BOVIN
[Raw transfer]




GDP_A_3(3CB2)
TBG1_HUMAN
[Raw transfer]




GDP_B_7(4UXO)
TBB2B_BOVIN
[Raw transfer]




GDP_B_7(4UXR)
TBB2B_BOVIN
[Raw transfer]




GDP_B_7(4UXP)
TBB2B_BOVIN
[Raw transfer]




GTP_B_4(3DCO)
TBB2B_BOVIN
[Raw transfer]




GTP_B_8(2P4N)
TBB2B_BOVIN
[Raw transfer]




GTP_A_3(1TUB)
TBB_PIG
[Raw transfer]




GTP_C_7(2WBE)
TBB2B_BOVIN
[Raw transfer]




GTP_A_6(2HXH)
TBB_PIG
[Raw transfer]




GTP_A_5(1JFF)
TBB_PIG
[Raw transfer]




GTP_A_6(2HXF)
TBB_PIG
[Raw transfer]




3 PsiBlast_PDB 87.6499% -85 - C3 -5IJ9 - TBB3_HUMAN -
2 PsiBlast_PDB 87.48100% -87 - C3 -5IJ0 - TBB3_HUMAN -
1 PsiBlast_PDB 87.36100% -84 - C3 -5JCO - TBB3_HUMAN -
37 HHSearch 86.8593% -86 - C3 -5IYZ - TBB2B_BOVIN -
40 HHSearch 85.1394% -86 - C3 -5N5N - TBB5_HUMAN -
13 PsiBlast_PDB 84.6594% -80 - C3 -3DCO 6.8 TBB2B_BOVIN
17 PsiBlast_PDB 84.5194% -80 - C3 -3J2U - TBB2B_BOVIN -
20 PsiBlast_PDB 84.4494% - - C3 -4UXR 3.5 TBB2B_BOVIN
19 PsiBlast_PDB 84.4494% - - C3 -4UXP 3.5 TBB2B_BOVIN
18 PsiBlast_PDB 84.4494% - - C3 -4UXO 3.5 TBB2B_BOVIN
12 PsiBlast_PDB 84.4194% -80 - C3 -3EDL - ? -
11 PsiBlast_PDB 84.3994% -81 - C3 -2P4N 6.8 TBB2B_BOVIN
5 PsiBlast_PDB 84.3894% -81 - C3 -1JFF 3.2 TBB_PIG
10 PsiBlast_PDB 84.3794% -80 - C3 -2HXH 3.3 TBB_PIG
9 PsiBlast_PDB 84.3794% -80 - C3 -2HXF 3.3 TBB_PIG
16 PsiBlast_PDB 84.2394% -81 - C3 -4ABO - TBB_PIG -
14 PsiBlast_PDB 84.2294% -80 - C3 -2WBE 3.3 TBB2B_BOVIN
15 PsiBlast_PDB 84.2094% -81 - C3 -3IZ0 - TBB2B_BOVIN -
7 PsiBlast_PDB 83.9494% -89 - C3 -1SA0 - TBB2B_BOVIN -
8 PsiBlast_PDB 83.3694% -82 - C3 -1SA1 - TBB2B_BOVIN -
21 Fugue 76.8194% -8 - C3 -1TUB 2.9 TBB_PIG
47 HHSearch 69.2943% -86 - C3 -5ND4 6.3 TBA1B_BOVIN
41 HHSearch 63.0034% -9 - C3 -3CB2 9.0 TBG1_HUMAN