@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : TBB4B_HUMAN: (2018-10-06 )
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_B_5(5SYG)
TBB_PIG
[Raw transfer]




GDP_B_6(5HNY)
TBB2B_BOVIN
[Raw transfer]




GDP_B_5(5SYC)
TBB_PIG
[Raw transfer]




GDP_B_9(5ND4)
TBB2B_BOVIN
[Raw transfer]




GDP_C_3(1TVK)
TBB2B_BOVIN
[Raw transfer]




GDP_B_6(5KMG)
TBB_PIG
[Raw transfer]




GTP_A_7(5ND4)
TBA1B_BOVIN
[Raw transfer]




G2P_B_7(3J6H)
TBB_PIG
[Raw transfer]




GDP_B_5(5SYE)
TBB_PIG
[Raw transfer]




GDP_B_5(5SYF)
TBB_PIG
[Raw transfer]




GDP_A_3(3CB2)
TBG1_HUMAN
[Raw transfer]




GDP_B_4(1TUB)
TBB_PIG
[Raw transfer]




GDP_B_4(1TUB)
TBB_PIG
[Raw transfer]




GDP_B_7(4UY0)
TBB2B_BOVIN
[Raw transfer]




13 PsiBlast_PDB 86.8498% -92 - C4 -5SYG 6.9 TBB_PIG
7 PsiBlast_PDB 86.5798% -87 - C4 -3J6F - TBB_PIG -
1 PsiBlast_PDB 86.3898% -87 - C4 -5KMG 8.4 TBB_PIG
10 PsiBlast_PDB 86.2398% -89 - C4 -5SYC 6.4 TBB_PIG
14 PsiBlast_PDB 86.2098% - - C4 -4UY0 3.5 TBB2B_BOVIN
8 PsiBlast_PDB 85.9798% -93 - C4 -3J6G - TBB_PIG -
6 PsiBlast_PDB 85.8798% -91 - C4 -3J6E - TBB_PIG -
40 HHSearch 85.7697% -86 - C4 -5IYZ - TBB2B_BOVIN -
11 PsiBlast_PDB 85.7598% -86 - C4 -5SYE 6.1 TBB_PIG
12 PsiBlast_PDB 85.6998% -87 - C4 -5SYF 6.0 TBB_PIG
18 PsiBlast_PDB 85.5098% -93 - C4 -5M5C - TBB2B_BOVIN -
17 PsiBlast_PDB 85.2198% -92 - C4 -5M54 - TBB2B_BOVIN -
9 PsiBlast_PDB 84.9098% -93 - C4 -5M50 - TBB2B_BOVIN -
20 PsiBlast_PDB 84.2198% -84 - C4 -5N5N - TBB5_HUMAN -
39 HHSearch 83.9598% -85 * C4 *5N5N - TBB5_HUMAN -
19 PsiBlast_PDB 83.5798% -74 - C4 -5ND4 4.3 TBB2B_BOVIN
16 PsiBlast_PDB 83.3898% -81 - C4 -5HNY 6.0 TBB2B_BOVIN
15 PsiBlast_PDB 82.3198% -74 - C4 -3J6H 2.3 TBB_PIG
3 PsiBlast_PDB 82.2198% -81 - C4 -1TVK 5.5 TBB2B_BOVIN
5 PsiBlast_PDB 81.5998% -71 - C4 -3J1U - TBB2B_BOVIN -
2 PsiBlast_PDB 77.2798% -61 - C4 -1TUB 4.5 TBB_PIG
21 Fugue 71.8698% 2 - C4 -1TUB 4.5 TBB_PIG
47 HHSearch 67.9342% -85 - C4 -5ND4 6.3 TBA1B_BOVIN
41 HHSearch 59.1935% -2 - C4 -3CB2 9.0 TBG1_HUMAN