@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : TBB5_HUMAN: (2018-10-06 )
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GTP_A_7(5ND4)
TBA1B_BOVIN
[Raw transfer]




GDP_A_3(3CB2)
TBG1_HUMAN
[Raw transfer]




GDP_B_7(4UXP)
TBB2B_BOVIN
[Raw transfer]




GDP_B_7(4UXR)
TBB2B_BOVIN
[Raw transfer]




GDP_B_7(4UXO)
TBB2B_BOVIN
[Raw transfer]




GDP_B_7(4UXS)
TBB2B_BOVIN
[Raw transfer]




GTP_B_4(3DCO)
TBB2B_BOVIN
[Raw transfer]




GTP_B_8(2P4N)
TBB2B_BOVIN
[Raw transfer]




GTP_A_3(1TUB)
TBB_PIG
[Raw transfer]




GTP_C_7(2WBE)
TBB2B_BOVIN
[Raw transfer]




GTP_A_6(2HXH)
TBB_PIG
[Raw transfer]




GTP_A_5(1JFF)
TBB_PIG
[Raw transfer]




GTP_A_4(5KMG)
TBB_PIG
[Raw transfer]




GTP_A_6(2HXF)
TBB_PIG
[Raw transfer]




2 PsiBlast_PDB 89.8397% -89 - C2 -5KMG 3.1 TBB_PIG
37 HHSearch 89.7496% -88 - C2 -5IYZ - TBB2B_BOVIN -
1 PsiBlast_PDB 88.36100% -86 - C2 -5N5N - TBB5_HUMAN -
38 HHSearch 88.01100% -87 - C2 -5N5N - TBB5_HUMAN -
6 PsiBlast_PDB 86.9897% -91 - C2 -1SA0 - TBB2B_BOVIN -
12 PsiBlast_PDB 85.9097% -82 - C2 -3DCO 6.8 TBB2B_BOVIN
11 PsiBlast_PDB 85.8397% -83 - C2 -3EDL - ? -
20 PsiBlast_PDB 85.7697% - - C2 -4UXS 3.5 TBB2B_BOVIN
19 PsiBlast_PDB 85.7697% - - C2 -4UXR 3.5 TBB2B_BOVIN
18 PsiBlast_PDB 85.7697% - - C2 -4UXP 3.5 TBB2B_BOVIN
17 PsiBlast_PDB 85.7697% - - C2 -4UXO 3.5 TBB2B_BOVIN
4 PsiBlast_PDB 85.7597% -83 - C2 -1JFF 3.2 TBB_PIG
16 PsiBlast_PDB 85.6897% -82 - C2 -3J2U - TBB2B_BOVIN -
9 PsiBlast_PDB 85.5997% -82 - C2 -2HXH 3.3 TBB_PIG
8 PsiBlast_PDB 85.5997% -82 - C2 -2HXF 3.3 TBB_PIG
10 PsiBlast_PDB 85.5397% -83 - C2 -2P4N 6.8 TBB2B_BOVIN
13 PsiBlast_PDB 85.5297% -82 - C2 -2WBE 3.3 TBB2B_BOVIN
14 PsiBlast_PDB 85.4597% -83 - C2 -3IZ0 - TBB2B_BOVIN -
15 PsiBlast_PDB 85.4197% -83 - C2 -4ABO - TBB_PIG -
7 PsiBlast_PDB 85.1497% -84 - C2 -1SA1 - TBB2B_BOVIN -
47 HHSearch 71.5943% -87 - C2 -5ND4 6.3 TBA1B_BOVIN
21 Fugue 68.6498% 2 - C2 -1TUB 2.9 TBB_PIG
41 HHSearch 59.3133% -4 - C2 -3CB2 9.0 TBG1_HUMAN