@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CATL2_HUMAN: (2018-10-03 )
MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

5T9_A_3(5F02)
CATL1_HUMAN
[Raw transfer]




XU5_A_2(2XU5)
CATL1_HUMAN
[Raw transfer]




DJT_A_2(2XU4)
CATL1_HUMAN
[Raw transfer]




424_A_2(2YJC)
CATL1_HUMAN
[Raw transfer]




0IW_A_3(1FH0)
CATL2_HUMAN
[Raw transfer]




YJ9_A_2(2YJ9)
CATL1_HUMAN
[Raw transfer]




YJ2_A_2(2YJ2)
CATL1_HUMAN
[Raw transfer]




YJ9_A_2(2YJB)
CATL1_HUMAN
[Raw transfer]




YJ8_A_2(2YJ8)
CATL1_HUMAN
[Raw transfer]




NSY_A_7(3H8B)
CATL1_HUMAN
[Raw transfer]




3XT_A_2(4X6H)
CATK_HUMAN
[Raw transfer]




I0X_A_2(3OF9)
CATL1_HUMAN
[Raw transfer]




XU3_A_2(2XU3)
CATL1_HUMAN
[Raw transfer]




GOL_A_3(4AXL)
CATL1_HUMAN
[Raw transfer]




I0Y_A_2(3OF8)
CATL1_HUMAN
[Raw transfer]




XU3_A_2(2XU3)
CATL1_HUMAN
[Raw transfer]




GOL_A_3(2YJ9)
CATL1_HUMAN
[Raw transfer]




NSX_A_7(3H89)
CATL1_HUMAN
[Raw transfer]




GOL_A_3(2YJ2)
CATL1_HUMAN
[Raw transfer]




BTB_A_3(2XU3)
CATL1_HUMAN
[Raw transfer]




SBA_B_2(1BQI)
PAPA1_CARPA
[Raw transfer]




PG6_A_20(3QT4)
?
[Raw transfer]




PG4_A_15(3QT4)
?
[Raw transfer]




3 PsiBlast_PDB 88.6199% -69 - C2 -1FH0 7.5 CATL2_HUMAN
5 PsiBlast_PDB 87.9798% -70 - C2 -3KFQ - CATL2_HUMAN -
4 PsiBlast_PDB 87.9098% -71 - C2 -3H6S - CATL2_HUMAN -
6 PsiBlast_PDB 76.8478% -69 - C2 -3OF8 5.4 CATL1_HUMAN
9 PsiBlast_PDB 76.7779% -79 - C2 -3H8B 8.0 CATL1_HUMAN
7 PsiBlast_PDB 76.4378% -70 - C2 -3OF9 5.6 CATL1_HUMAN
8 PsiBlast_PDB 76.1979% -79 - C2 -3H89 8.3 CATL1_HUMAN
15 PsiBlast_PDB 76.0179% -74 - C2 -2YJ9 5.8 CATL1_HUMAN
20 PsiBlast_PDB 75.8279% -72 - C2 -5F02 5.0 CATL1_HUMAN
13 PsiBlast_PDB 75.7679% -72 - C2 -2YJ2 5.7 CATL1_HUMAN
57 HHSearch 75.7579% -71 - C2 -2XU3 4.8 CATL1_HUMAN
16 PsiBlast_PDB 75.6679% -68 - C2 -2YJB 5.4 CATL1_HUMAN
18 PsiBlast_PDB 75.6579% -73 - C2 -4AXL 3.5 CATL1_HUMAN
10 PsiBlast_PDB 75.4879% -71 - C2 -2XU3 4.8 CATL1_HUMAN
14 PsiBlast_PDB 75.4779% -72 - C2 -2YJ8 5.4 CATL1_HUMAN
39 HHSearch 75.3252% 22 - C2 -2C0Y - CATS_HUMAN -
11 PsiBlast_PDB 75.3179% -72 - C2 -2XU4 5.2 CATL1_HUMAN
19 PsiBlast_PDB 75.2979% -74 - C2 -4AXM - CATL1_HUMAN -
12 PsiBlast_PDB 75.1379% -70 - C2 -2XU5 5.9 CATL1_HUMAN
17 PsiBlast_PDB 75.0879% -70 - C2 -2YJC 5.1 CATL1_HUMAN
55 HHSearch 70.5859% -71 - C2 -4X6H 2.9 CATK_HUMAN
38 HHSearch 70.4143% 35 - C2 -3QT4 2.9 ?
62 HHSearch 58.0144% -23 - C2 -1BQI 3.9 PAPA1_CARPA