@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : DR9C7_HUMAN: (2018-10-03 )
MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTSYRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEVTLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAILGKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_3(1QYW)
DHB1_HUMAN
[Raw transfer]




GOL_E_5(1I5R)
DHB1_HUMAN
[Raw transfer]




21 HHSearch 79.6032% -38 - C4 -1JTV - DHB1_HUMAN -
1 PsiBlast_PDB 78.8134% -49 - C4 -2JAP - ? -
2 PsiBlast_PDB 78.1734% -49 - C4 -2JAH - ? -
4 PsiBlast_PDB 74.4731% -25 - C4 -1EQU - DHB1_HUMAN -
6 PsiBlast_PDB 74.1031% -17 - C4 -3DHE - DHB1_HUMAN -
14 PsiBlast_PDB 73.7331% -23 - C4 -3HB4 - DHB1_HUMAN -
3 PsiBlast_PDB 73.5831% -27 - C4 -1FDW - DHB1_HUMAN -
15 PsiBlast_PDB 73.4831% -23 - C4 -3HB5 - DHB1_HUMAN -
12 PsiBlast_PDB 73.1131% -22 - C4 -1BHS - DHB1_HUMAN -
7 PsiBlast_PDB 72.7231% -27 - C4 -1I5R 2.8 DHB1_HUMAN
18 PsiBlast_PDB 72.1431% -23 - C4 -1FDS - DHB1_HUMAN -
5 PsiBlast_PDB 72.0931% -21 - C4 -1DHT - DHB1_HUMAN -
20 PsiBlast_PDB 71.3631% -27 - C4 -3KLM - DHB1_HUMAN -
13 PsiBlast_PDB 71.3631% -27 - C4 -3DEY - DHB1_HUMAN -
19 PsiBlast_PDB 71.3331% -26 - C4 -1FDT - DHB1_HUMAN -
8 PsiBlast_PDB 70.9031% -28 - C4 -1JTV - DHB1_HUMAN -
17 PsiBlast_PDB 70.5931% -26 - C4 -3KM0 - DHB1_HUMAN -
30 HHSearch 70.1126% -49 - C4 -4YAG - ? -
10 PsiBlast_PDB 70.1131% -24 - C4 -1QYW 5.0 DHB1_HUMAN
16 PsiBlast_PDB 69.5131% -30 - C4 -3KLP - DHB1_HUMAN -