@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : KLK10_HUMAN: (2018-10-04 )
MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SVC_C_12(5MS4)
KLK8_HUMAN
[Raw transfer]




SVC_A_5(5MS4)
KLK8_HUMAN
[Raw transfer]




5VT_A_3(5FAH)
KLK7_HUMAN
[Raw transfer]




8R3_A_2(5Y9L)
KLK7_HUMAN
[Raw transfer]




8VX_A_2(5YJK)
KLK7_HUMAN
[Raw transfer]




K7J_A_2(2QXI)
KLK7_HUMAN
[Raw transfer]




K7J_A_4(2QXJ)
KLK7_HUMAN
[Raw transfer]




K7I_B_4(2QXG)
KLK7_HUMAN
[Raw transfer]




BEN_A_3(1LO6)
KLK6_HUMAN
[Raw transfer]




K7I_A_3(2QXG)
KLK7_HUMAN
[Raw transfer]




PR1_A_5(1F0T)
TRY1_BOVIN
[Raw transfer]




PEA_A_2(1UTO)
TRY1_BOVIN
[Raw transfer]




ABN_A_2(1UTN)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(5FXL)
TRY1_BOVIN
[Raw transfer]




SIN_A_3(5JYI)
TRY1_BOVIN
[Raw transfer]




NAG_A_4(2XXL)
GRASS_DROME
[Raw transfer]




6 PsiBlast_PDB 93.4742% -96 - C2 -2QXJ 4.7 KLK7_HUMAN
3 PsiBlast_PDB 93.4442% -98 - C2 -2QXG 3.3 KLK7_HUMAN
8 PsiBlast_PDB 93.1142%-100 - C2 -5YJK 5.2 KLK7_HUMAN
5 PsiBlast_PDB 93.0942% -99 - C2 -2QXI 4.6 KLK7_HUMAN
54 HHSearch 92.8144% -95 - C2 -2QXI - KLK7_HUMAN -
7 PsiBlast_PDB 92.7442%-101 - C2 -5Y9L 5.6 KLK7_HUMAN
11 PsiBlast_PDB 91.9844%-107 - C2 -1NPM - KLK8_MOUSE -
4 PsiBlast_PDB 91.8942%-100 - C2 -2QXH - KLK7_HUMAN -
53 HHSearch 91.7844% -93 - C2 -2QXG 4.2 KLK7_HUMAN
9 PsiBlast_PDB 91.2443% -97 - C2 -3BSQ - KLK7_HUMAN -
10 PsiBlast_PDB 89.0042% -95 - C2 -5FAH 7.5 KLK7_HUMAN
2 PsiBlast_PDB 86.5745% -43 - C2 -5MS4 2.6 KLK8_HUMAN
1 PsiBlast_PDB 86.5045% -44 - C2 -5MS3 - KLK8_HUMAN -
41 HHSearch 83.7146% -36 - C2 -5MS4 3.6 KLK8_HUMAN
12 PsiBlast_PDB 82.7641% -45 - C2 -4GUX - TRY1_BOVIN -
56 HHSearch 82.4035% -58 - C2 -1SPJ - KLK1_HUMAN -
17 PsiBlast_PDB 81.8341% -45 - C2 -1F0U - TRY1_BOVIN -
13 PsiBlast_PDB 81.4741% -42 - C2 -4XOJ - TRY1_BOVIN -
16 PsiBlast_PDB 81.3941% -41 - C2 -1F0T 4.6 TRY1_BOVIN
15 PsiBlast_PDB 81.3741% -49 - C2 -5JYI 4.1 TRY1_BOVIN
20 PsiBlast_PDB 80.4441% -43 - C2 -1UTO 3.5 TRY1_BOVIN
57 HHSearch 78.8341% -49 - C2 -1LO6 2.6 KLK6_HUMAN