@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SAP3_HUMAN: (2018-10-04 )
MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IPA_Q_17(2AG9)
SAP3_HUMAN
[Raw transfer]




LP3_A_13(2AG2)
SAP3_HUMAN
[Raw transfer]




OLA_B_2(2AF9)
SAP3_HUMAN
[Raw transfer]




DAO_D_4(2AGC)
SAP3_MOUSE
[Raw transfer]




LPE_A_17(1TJJ)
SAP3_HUMAN
[Raw transfer]




2SP_B_2(1PUB)
SAP3_HUMAN
[Raw transfer]




2SP_B_2(1PUB)
SAP3_HUMAN
[Raw transfer]




IPA_H_8(2AG4)
SAP3_HUMAN
[Raw transfer]




LP3_A_12(2AG2)
SAP3_HUMAN
[Raw transfer]




PFS_A_14(1TJJ)
SAP3_HUMAN
[Raw transfer]




LP3_C_3(2AG4)
SAP3_HUMAN
[Raw transfer]




LP3_D_4(2AG4)
SAP3_HUMAN
[Raw transfer]




IPA_A_21(2AG2)
SAP3_HUMAN
[Raw transfer]




MYR_B_2(2AGC)
SAP3_MOUSE
[Raw transfer]




MYR_C_3(2AF9)
SAP3_HUMAN
[Raw transfer]




EPE_A_4(1G13)
SAP3_HUMAN
[Raw transfer]




DAO_E_5(2AF9)
SAP3_HUMAN
[Raw transfer]




8 PsiBlast_PDB 91.2798%-112 - C5 -1G13 - SAP3_HUMAN -
2 PsiBlast_PDB 90.7997%-109 - C5 -1PU5 - SAP3_HUMAN -
5 PsiBlast_PDB 90.7797%-108 - C5 -2AG2 7.8 SAP3_HUMAN
3 PsiBlast_PDB 90.5397%-107 - C5 -1TJJ 7.4 SAP3_HUMAN
6 PsiBlast_PDB 90.0997%-104 - C5 -2AG4 6.6 SAP3_HUMAN
11 HHSearch 89.7898% -99 - C5 -2AG4 6.0 SAP3_HUMAN
7 PsiBlast_PDB 87.3796% -98 - C5 -2AG9 Error SAP3_HUMAN
4 PsiBlast_PDB 87.0297%-100 - C5 -2AF9 5.8 SAP3_HUMAN
1 PsiBlast_PDB 86.55100%-104 - C5 -1PUB 7.0 SAP3_HUMAN
10 HHSearch 86.47100%-108 - C5 -1PUB 7.0 SAP3_HUMAN
30 Fugue 82.17100% -6 - C5 -1G13 2.5 SAP3_HUMAN
9 PsiBlast_PDB 78.9074%-101 - C5 -2AGC 4.3 SAP3_MOUSE
44 Fugue 42.5513% -93 * C5 *2E56 - LY96_HUMAN -
12 HHSearch 41.2319% -45 - C5 -2E56 - LY96_HUMAN -
14 HHSearch 38.2512% -85 - C5 -3M7O - LY86_MOUSE -
28 HHSearch 37.9710%-189 - C5 -1ROC - ASF1_YEAST -
18 HHSearch 37.1016% 5 - C5 -2HKA - NPC2_BOVIN -
23 HHSearch 36.9619% 17 - C5 -1XWV - ALL2_DERFA -
15 HHSearch 36.7112% -78 - C5 -3M7O - LY86_MOUSE -
17 HHSearch 36.1116% 10 - C5 -1NEP - NPC2_BOVIN -