@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : GRAP2_MOUSE: (2018-07-13 )
MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_F_20(1R1P)
GRAP2_MOUSE
[Raw transfer]




AYI_A_3(3IMJ)
GRB2_HUMAN
[Raw transfer]




FYQ_A_3(3IMD)
GRB2_HUMAN
[Raw transfer]




FYI_A_2(3IN8)
GRB2_HUMAN
[Raw transfer]




YEN_A_2(3KFJ)
GRB2_HUMAN
[Raw transfer]




AYQ_A_3(3IN7)
GRB2_HUMAN
[Raw transfer]




GOL_B_3(3N8M)
GRB2_HUMAN
[Raw transfer]




ACE_I_9(1FYR)
GRB2_HUMAN
[Raw transfer]




4 PsiBlast_PDB 83.9090%-155 - C1 -5GJH - GRAP2_HUMAN -
2 PsiBlast_PDB 83.5698%-160 - C1 -1R1Q - GRAP2_MOUSE -
1 PsiBlast_PDB 83.5398%-155 - C1 -1R1P - GRAP2_MOUSE -
3 PsiBlast_PDB 82.6698%-149 - C1 -1R1S - GRAP2_MOUSE -
37 HHSearch 80.1399%-135 - C1 -1R1P Error GRAP2_MOUSE
5 PsiBlast_PDB 76.5652% -51 - C1 -1GRI - GRB2_HUMAN -
20 PsiBlast_PDB 61.1255% -23 - C1 -3N8M 2.7 GRB2_HUMAN
18 PsiBlast_PDB 60.6255% -17 - C1 -3IN8 8.1 GRB2_HUMAN
17 PsiBlast_PDB 60.4355% -17 - C1 -3IN7 7.5 GRB2_HUMAN
15 PsiBlast_PDB 60.1455% -13 - C1 -3IMD 7.1 GRB2_HUMAN
19 PsiBlast_PDB 60.0555% -14 - C1 -3KFJ 7.0 GRB2_HUMAN
12 PsiBlast_PDB 59.8853% -19 - C1 -1BMB - GRB2_HUMAN -
16 PsiBlast_PDB 59.5555% -14 - C1 -3IMJ 7.6 GRB2_HUMAN
27 HHSearch 59.1624% -69 * C1 *2LQN - CRKL_HUMAN -
14 PsiBlast_PDB 58.4655% -9 - C1 -3N84 - GRB2_HUMAN -
21 HHSearch 56.3836% 16 - C1 -4U5W - HCK_HUMAN -
25 HHSearch 56.1636% 22 - C1 -5H0B - HCK_HUMAN -
28 HHSearch 55.8828% -4 - C1 -3QWX - CED2_CAEEL -
26 HHSearch 54.8237% 19 - C1 -2HCK - HCK_HUMAN -
23 HHSearch 54.5830% 5 - C1 -1FMK - SRC_HUMAN -
13 PsiBlast_PDB 52.2452% -65 - C1 -1FYR 3.4 GRB2_HUMAN