@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : AAKG1_HUMAN: (2018-07-12 )
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_E_5(2V92)
AAKG1_RAT
[Raw transfer]




ATP_E_5(2V9J)
AAKG1_RAT
[Raw transfer]




ADP_C_13(4QFR)
AAKG1_RAT
[Raw transfer]




ADP_C_13(4QFR)
AAKG1_RAT
[Raw transfer]




ADP_C_12(5KQ5)
AAKG1_RAT
[Raw transfer]




ADP_E_4(2Y8Q)
AAKG1_RAT
[Raw transfer]




ADP_C_12(5T5T)
AAKG1_RAT
[Raw transfer]




ADP_C_12(5UFU)
AAKG1_RAT
[Raw transfer]




AMP_C_11(4QFS)
AAKG1_RAT
[Raw transfer]




J7V_E_5(2YA3)
AAKG1_RAT
[Raw transfer]




AMP_E_6(2V8Q)
AAKG1_RAT
[Raw transfer]




AMP_E_6(2V8Q)
AAKG1_RAT
[Raw transfer]




ATP_C_5(4EAK)
AAKG1_RAT
[Raw transfer]




AMP_E_7(4CFH)
AAKG1_RAT
[Raw transfer]




ADP_E_5(2Y8L)
AAKG1_RAT
[Raw transfer]




AMP_G_7(4REW)
AAKG1_HUMAN
[Raw transfer]




AMP_E_4(2V8Q)
AAKG1_RAT
[Raw transfer]




AMP_C_9(4QFG)
AAKG1_RAT
[Raw transfer]




AMP_C_5(4EAL)
AAKG1_RAT
[Raw transfer]




AMP_A_2(2UV4)

[Raw transfer]




3 PsiBlast_PDB 97.62100%-201 - C1 -5ISO - AAKG1_HUMAN -
32 HHSearch 95.81100%-197 - C1 -4REW 5.1 AAKG1_HUMAN
5 PsiBlast_PDB 95.73100%-194 - C1 -5EZV - AAKG1_HUMAN -
4 PsiBlast_PDB 95.73100%-204 - C1 -4ZHX - AAKG1_HUMAN -
9 PsiBlast_PDB 95.5296%-196 - C1 -2Y8L 7.2 AAKG1_RAT
11 PsiBlast_PDB 95.1396%-200 - C1 -2YA3 9.4 AAKG1_RAT
8 PsiBlast_PDB 94.4296%-190 - C1 -2V9J 5.8 AAKG1_RAT
2 PsiBlast_PDB 93.72100%-190 - C1 -4CFF - AAKG1_HUMAN -
19 PsiBlast_PDB 93.6696%-199 - C1 -5T5T 6.8 AAKG1_RAT
7 PsiBlast_PDB 93.3996%-189 - C1 -2V92 7.5 AAKG1_RAT
10 PsiBlast_PDB 93.2796%-184 - C1 -2Y8Q 6.3 AAKG1_RAT
14 PsiBlast_PDB 93.1196%-198 - C1 -4CFH 5.4 AAKG1_RAT
31 HHSearch 92.9299%-187 - C1 -2V8Q 6.3 AAKG1_RAT
20 PsiBlast_PDB 92.9196%-203 - C1 -5UFU 6.4 AAKG1_RAT
15 PsiBlast_PDB 92.8896%-204 - C1 -4QFG 5.1 AAKG1_RAT
1 PsiBlast_PDB 92.76100%-197 - C1 -4CFE - AAKG1_HUMAN -
23 Fugue 92.7198%-187 - C1 -2V8Q 6.3 AAKG1_RAT
6 PsiBlast_PDB 92.2896%-187 - C1 -2V8Q 7.9 AAKG1_RAT
21 Fugue 92.2298%-205 - C1 -4QFR 5.8 AAKG1_RAT
13 PsiBlast_PDB 91.9796%-194 - C1 -4EAL 4.6 AAKG1_RAT
16 PsiBlast_PDB 91.8496%-205 - C1 -4QFR 5.8 AAKG1_RAT
12 PsiBlast_PDB 91.6396%-188 - C1 -4EAK 5.9 AAKG1_RAT
18 PsiBlast_PDB 91.1996%-205 - C1 -5KQ5 6.6 AAKG1_RAT
17 PsiBlast_PDB 87.5896%-212 - C1 -4QFS 3.8 AAKG1_RAT
24 Fugue 58.2399%-169 - C1 -2UV4 5.4