@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : AIFM1_HUMAN: (2018-07-12 )
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_A_2(4BV6)
AIFM1_HUMAN
[Raw transfer]




FAD_B_2(1M6I)
AIFM1_HUMAN
[Raw transfer]




FAD_B_2(1M6I)
AIFM1_HUMAN
[Raw transfer]




FAD_A_2(4LII)
AIFM1_HUMAN
[Raw transfer]




FAD_A_2(4BV6)
AIFM1_HUMAN
[Raw transfer]




FAD_A_2(5FMH)
AIFM1_HUMAN
[Raw transfer]




FAD_A_3(5FS9)
AIFM1_HUMAN
[Raw transfer]




FAD_A_2(5KVI)
AIFM1_HUMAN
[Raw transfer]




FAD_A_3(3GD4)
AIFM1_MOUSE
[Raw transfer]




FAD_A_3(5FS6)
AIFM1_HUMAN
[Raw transfer]




FAD_A_4(5MIV)
AIFM1_MOUSE
[Raw transfer]




FAD_A_3(5FS7)
AIFM1_HUMAN
[Raw transfer]




FAD_A_2(5FS8)
AIFM1_HUMAN
[Raw transfer]




FAD_A_2(5FS8)
AIFM1_HUMAN
[Raw transfer]




FAD_A_3(5MIU)
AIFM1_MOUSE
[Raw transfer]




FAD_A_3(1GV4)
AIFM1_MOUSE
[Raw transfer]




GOL_A_3(4H4R)
?
[Raw transfer]




FMT_A_8(4H4R)
?
[Raw transfer]




GOL_A_7(3EF6)
TODA_PSEP1
[Raw transfer]




16 PsiBlast_PDB 94.8491% -98 - C1 -1GV4 14.1 AIFM1_MOUSE
9 PsiBlast_PDB 94.6298%-101 - C1 -4LII 14.2 AIFM1_HUMAN
32 HHSearch 93.85100%-102 - C1 -4BV6 14.1 AIFM1_HUMAN
31 HHSearch 93.85100%-101 - C1 -5FS8 13.8 AIFM1_HUMAN
11 PsiBlast_PDB 93.85100%-102 - C1 -4BV6 14.1 AIFM1_HUMAN
8 PsiBlast_PDB 93.6399%-101 - C1 -5FS8 13.8 AIFM1_HUMAN
4 PsiBlast_PDB 93.4799%-113 - C1 -5FS6 14.2 AIFM1_HUMAN
5 PsiBlast_PDB 93.3299%-114 - C1 -5FS7 13.6 AIFM1_HUMAN
1 PsiBlast_PDB 93.1499%-125 - C1 -5KVH - AIFM1_HUMAN -
6 PsiBlast_PDB 93.1199%-104 - C1 -5FS9 13.8 AIFM1_HUMAN
2 PsiBlast_PDB 93.0399% -98 - C1 -5KVI 13.4 AIFM1_HUMAN
3 PsiBlast_PDB 92.67100%-119 - C1 -4BUR - AIFM1_HUMAN -
7 PsiBlast_PDB 92.1399% -97 - C1 -5FMH 13.7 AIFM1_HUMAN
13 PsiBlast_PDB 92.1293%-111 - C1 -5MIU 13.2 AIFM1_MOUSE
10 PsiBlast_PDB 91.48100%-102 - C1 -1M6I 14.0 AIFM1_HUMAN
21 Fugue 90.8099%-100 - C1 -1M6I 14.0 AIFM1_HUMAN
12 PsiBlast_PDB 90.3493%-100 - C1 -3GD3 - AIFM1_MOUSE -
15 PsiBlast_PDB 90.1193%-121 - C1 -3GD4 12.9 AIFM1_MOUSE
14 PsiBlast_PDB 90.0893%-120 - C1 -5MIV 12.4 AIFM1_MOUSE
38 HHSearch 51.8822% -98 - C1 -3EF6 - TODA_PSEP1 -