@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SIAH1_HUMAN: (2018-07-13 )
MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BME_A_11(1K2F)
SIA1A_MOUSE
[Raw transfer]




MPD_A_7(4I7D)
SIAH1_HUMAN
[Raw transfer]




BME_A_12(1K2F)
SIA1A_MOUSE
[Raw transfer]




GOL_A_8(4C9Z)
SIAH1_HUMAN
[Raw transfer]




BME_A_12(1K2F)
SIA1A_MOUSE
[Raw transfer]




GOL_A_11(4CA1)
SIAH1_HUMAN
[Raw transfer]




GOL_B_21(4CA1)
SIAH1_HUMAN
[Raw transfer]




32 HHSearch 94.6699%-184 - C4 -1K2F Error SIA1A_MOUSE
21 Fugue 92.3899%-177 - C4 -1K2F 3.3 SIA1A_MOUSE
10 PsiBlast_PDB 92.3899%-177 - C4 -1K2F 3.3 SIA1A_MOUSE
4 PsiBlast_PDB 91.7399%-172 - C4 -4C9Z 2.8 SIAH1_HUMAN
2 PsiBlast_PDB 91.53100%-180 - C4 -4I7B - SIAH1_HUMAN -
6 PsiBlast_PDB 91.19100%-187 - C4 -4X3G - SIAH1_HUMAN -
7 PsiBlast_PDB 91.1299%-180 - C4 -4I7C - SIAH1_HUMAN -
9 PsiBlast_PDB 90.91100%-172 - C4 -5WZZ - SIAH1_HUMAN -
3 PsiBlast_PDB 90.42100%-181 - C4 -4I7D 3.7 SIAH1_HUMAN
31 HHSearch 90.3198%-169 - C4 -4CA1 2.8 SIAH1_HUMAN
5 PsiBlast_PDB 89.7799%-173 - C4 -4CA1 3.0 SIAH1_HUMAN
8 PsiBlast_PDB 89.3599%-167 - C4 -2AN6 - SIA1A_MOUSE -
11 PsiBlast_PDB 88.6686%-174 - C4 -5H9M - SIAH2_HUMAN -
1 PsiBlast_PDB 81.32100%-207 - C4 -2A25 - SIAH1_HUMAN -
22 Fugue 44.4733%-215 - C4 -4AUQ - BIRC7_HUMAN -
24 Fugue 42.3925%-194 - C4 -2YSJ - TRI31_HUMAN -
23 Fugue 36.8917%-186 - C4 -2EA5 - -
12 PsiBlast_PDB 36.6746%-244 - C4 -4AUQ - BIRC7_HUMAN -
13 PsiBlast_PDB 36.3340%-126 - C4 -3T6P - BIRC2_HUMAN -
52 HHSearch 35.8133% -68 - C4 -1Z6U - UHRF2_HUMAN -