@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SIAH2_HUMAN: (2018-07-14 )
MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BME_A_11(1K2F)
SIA1A_MOUSE
[Raw transfer]




MPD_A_7(4I7D)
SIAH1_HUMAN
[Raw transfer]




BME_A_12(1K2F)
SIA1A_MOUSE
[Raw transfer]




BME_A_12(1K2F)
SIA1A_MOUSE
[Raw transfer]




GOL_A_8(4C9Z)
SIAH1_HUMAN
[Raw transfer]




GOL_A_11(4CA1)
SIAH1_HUMAN
[Raw transfer]




GOL_B_21(4CA1)
SIAH1_HUMAN
[Raw transfer]




1 PsiBlast_PDB 91.99100%-178 - C2 -5H9M - SIAH2_HUMAN -
32 HHSearch 90.8588%-185 - C2 -1K2F Error SIA1A_MOUSE
5 PsiBlast_PDB 88.8486%-176 - C2 -4C9Z 2.8 SIAH1_HUMAN
21 Fugue 88.3987%-180 - C2 -1K2F 3.3 SIA1A_MOUSE
9 PsiBlast_PDB 88.3987%-180 - C2 -1K2F 3.3 SIA1A_MOUSE
31 HHSearch 88.3685%-171 - C2 -4CA1 2.8 SIAH1_HUMAN
3 PsiBlast_PDB 88.3686%-184 - C2 -4I7B - SIAH1_HUMAN -
4 PsiBlast_PDB 88.1086%-184 - C2 -4I7D 3.7 SIAH1_HUMAN
10 PsiBlast_PDB 87.9186%-184 - C2 -4I7C - SIAH1_HUMAN -
7 PsiBlast_PDB 87.2086%-190 - C2 -4X3G - SIAH1_HUMAN -
11 PsiBlast_PDB 86.4486%-174 - C2 -5WZZ - SIAH1_HUMAN -
6 PsiBlast_PDB 86.3086%-176 - C2 -4CA1 3.0 SIAH1_HUMAN
8 PsiBlast_PDB 85.6286%-171 - C2 -2AN6 - SIA1A_MOUSE -
2 PsiBlast_PDB 80.3486%-210 - C2 -2A25 - SIAH1_HUMAN -
26 Fugue 45.6325%-195 - C2 -2YSJ - TRI31_HUMAN -
24 Fugue 43.1320%-171 - C2 -2DJB - -
12 PsiBlast_PDB 40.3134%-204 - C2 -4AUQ - BIRC7_HUMAN -
17 PsiBlast_PDB 38.6432%-128 - C2 -2CT2 - TRI32_HUMAN -
45 HHSearch 36.9126%-180 - C2 -5AIE - NOT4_YEAST -
48 HHSearch 36.7624% -81 - C2 -2F42 - ? -