@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A8MY80_HUMAN: (2017-05-31 )
WFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFY

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




MLA_D_21(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_A_13(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_C_18(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_E_24(5EEL)
GRB7_HUMAN
[Raw transfer]




CHAIN_L_5(3PQZ)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

MLA_A_3(4WWQ)
GRB7_HUMAN
[Raw transfer]




FMT_D_22(5EEL)
GRB7_HUMAN
[Raw transfer]




FMT_B_16(5EEL)
GRB7_HUMAN
[Raw transfer]




CHAIN_B_2(1MW4)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_B_2(2L4K)

[Raw transfer]

-

1 PsiBlast_PDB 86.70100% - - C2 -3M7F - GRB10_MOUSE -
152 HHSearch 85.40100%-209 - C2 -1NRV - GRB10_HUMAN -
2 PsiBlast_PDB 85.40100%-209 - C2 -1NRV - GRB10_HUMAN -
29 PsiBlast_CBE 83.5267%-197 - C2 -5EEL 2.9 GRB7_HUMAN
23 PsiBlast_CBE 83.5267%-196 - C2 -3PQZ 7.2 GRB7_HUMAN
8 PsiBlast_PDB 83.3567%-197 - C2 -5D0J - GRB7_HUMAN -
150 HHSearch 83.1970%-195 - C2 -2AUG - GRB14_HUMAN -
11 PsiBlast_PDB 82.9669%-195 - C2 -2AUG - GRB14_HUMAN -
27 PsiBlast_CBE 82.2367%-186 - C2 -5EEL 4.3 GRB7_HUMAN
5 PsiBlast_PDB 82.1767%-191 - C2 -2QMS - GRB7_HUMAN -
26 PsiBlast_CBE 81.6567%-190 - C2 -5EEL 3.5 GRB7_HUMAN
151 HHSearch 81.4767%-203 - C2 -3PQZ 3.0 GRB7_HUMAN
3 PsiBlast_PDB 81.4767%-203 - C2 -3PQZ 3.0 GRB7_HUMAN
9 PsiBlast_PDB 81.3367%-191 - C2 -5EEL 4.4 GRB7_HUMAN
12 PsiBlast_PDB 81.0167%-176 - C2 -4X6S - GRB7_HUMAN -
10 PsiBlast_PDB 80.6367%-189 - C2 -5EEQ - GRB7_HUMAN -
22 PsiBlast_CBE 80.4467%-180 - C2 -3PQZ 2.4 GRB7_HUMAN
7 PsiBlast_PDB 80.3267%-195 - C2 -4WWQ 3.0 GRB7_HUMAN
21 PsiBlast_CBE 79.7067%-183 - C2 -3PQZ 2.3
28 PsiBlast_CBE 79.5767%-190 - C2 -5EEL 4.2 GRB7_HUMAN
4 PsiBlast_PDB 53.0867% -89 - C2 -1MW4 2.7
6 PsiBlast_PDB 47.6567% -71 - C2 -2L4K 9.2