@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0LPF3_HUMAN: (2017-05-31 )
WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

Atome Classification :

(79 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

C78_Q_17(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_S_19(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_P_16(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_N_14(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_W_23(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_M_13(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_T_20(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_R_18(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_O_15(1CJ1)
GRB2_HUMAN
[Raw transfer]




YVN_E_5(2HUW)
GRB2_HUMAN
[Raw transfer]




C78_V_22(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_U_21(1CJ1)
GRB2_HUMAN
[Raw transfer]




TVN_A_2(3C7I)
GRB2_HUMAN
[Raw transfer]




FYQ_A_3(3IMD)
GRB2_HUMAN
[Raw transfer]




AYI_A_3(3IMJ)
GRB2_HUMAN
[Raw transfer]




AYI_B_4(3IMJ)
GRB2_HUMAN
[Raw transfer]




FYQ_B_8(3IMD)
GRB2_HUMAN
[Raw transfer]




FYI_A_2(3IN8)
GRB2_HUMAN
[Raw transfer]




YVN_D_4(2HUW)
GRB2_HUMAN
[Raw transfer]




S1S_E_5(2AOB)
GRB2_HUMAN
[Raw transfer]




YEN_A_2(3KFJ)
GRB2_HUMAN
[Raw transfer]




S1S_C_3(2AOA)
GRB2_HUMAN
[Raw transfer]




S1S_K_11(2AOB)
GRB2_HUMAN
[Raw transfer]




AYQ_A_3(3IN7)
GRB2_HUMAN
[Raw transfer]




AYQ_C_4(3IN7)
GRB2_HUMAN
[Raw transfer]




GOL_C_3(2H46)
GRB2_HUMAN
[Raw transfer]




CHAIN_H_8(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_H_4(1JYQ)
GRB2_HUMAN
[Raw transfer]

-

GOL_B_7(3S8N)
GRB2_HUMAN
[Raw transfer]




CHAIN_H_8(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

DTF_A_2(1X0N)
GRB2_HUMAN
[Raw transfer]




GOL_B_3(3N8M)
GRB2_HUMAN
[Raw transfer]




CHAIN_H_8(3N84)
GRB2_HUMAN
[Raw transfer]

-

S1S_H_8(2AOB)
GRB2_HUMAN
[Raw transfer]




CHAIN_H_8(1R1S)
GRAP2_MOUSE
[Raw transfer]

-

GOL_A_3(5DC4)

[Raw transfer]




CHAIN_L_3(1JYQ)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_I_2(1ZFP)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_I_2(1ZFP)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(4JMG)
?
[Raw transfer]

-

CHAIN_E_5(3N7Y)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_J_10(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3WA4)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_L_12(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3WA4)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_D_4(3N7Y)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(4JMH)
?
[Raw transfer]

-

CHAIN_K_11(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_I_2(1BMB)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_K_7(1FYR)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_I_5(1FYR)
GRB2_HUMAN
[Raw transfer]

-

S1S_E_5(2AOA)
GRB2_HUMAN
[Raw transfer]




CHAIN_J_6(1FYR)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_L_8(1FYR)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(4P9V)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_F_6(3N7Y)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3S8L)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3S8O)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3S8N)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_D_4(1R1S)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_B_2(3OV1)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3OVE)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3OV1)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(4P9Z)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(1R1S)
GRAP2_MOUSE
[Raw transfer]

-

ACE_K_11(1FYR)
GRB2_HUMAN
[Raw transfer]




CHAIN_C_3(2H5K)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_F_6(1R1S)
GRAP2_MOUSE
[Raw transfer]

-

ACE_I_9(1FYR)
GRB2_HUMAN
[Raw transfer]




CHAIN_B_2(3N8M)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_I_2(1QG1)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_L_2(3MXY)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_L_2(3MXC)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_F_6(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_G_7(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

S1S_N_14(2AOB)
GRB2_HUMAN
[Raw transfer]




CHAIN_J_10(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_E_5(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_I_2(1TZE)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_E_5(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_L_2(1JYR)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_C_3(1R1Q)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_D_4(1R1Q)
GRAP2_MOUSE
[Raw transfer]

-

32 PsiBlast_CBE 96.00100%-143 - C2 -3C7I 8.0 GRB2_HUMAN
29 PsiBlast_CBE 95.99100%-159 - C2 -3IN7 7.7 GRB2_HUMAN
8 PsiBlast_PDB 95.92100%-154 - C2 -3IN7 7.5 GRB2_HUMAN
13 PsiBlast_PDB 95.81100%-139 - C2 -3S8L 7.8 GRB2_HUMAN
7 PsiBlast_PDB 95.80100%-153 - C2 -3IMJ 7.5 GRB2_HUMAN
266 HHSearch 95.68100%-148 - C2 -3OV1 7.7 GRB2_HUMAN
12 PsiBlast_PDB 95.68100%-148 - C2 -3OV1 7.7 GRB2_HUMAN
14 PsiBlast_PDB 95.56100%-143 - C2 -3S8N 8.3 GRB2_HUMAN
53 PsiBlast_CBE 95.53100%-131 - C2 -1TZE 7.7 GRB2_HUMAN
1 PsiBlast_PDB 95.34100%-149 - C2 -3OVE 8.2 GRB2_HUMAN
16 PsiBlast_PDB 95.30100%-148 - C2 -4P9V 8.1 GRB2_HUMAN
30 PsiBlast_CBE 95.25100%-146 - C2 -3IMJ 8.4 GRB2_HUMAN
18 PsiBlast_PDB 95.16100%-141 - C2 -1BMB 8.1 GRB2_HUMAN
31 PsiBlast_CBE 95.14100%-136 - C2 -3IMD 6.9 GRB2_HUMAN
37 PsiBlast_CBE 95.12100%-141 - C2 -1JYR 7.4 GRB2_HUMAN
34 PsiBlast_CBE 95.06100%-145 - C2 -2HUW 7.8 GRB2_HUMAN
17 PsiBlast_PDB 95.06100%-142 - C2 -4P9Z 8.8 GRB2_HUMAN
33 PsiBlast_CBE 94.93100%-142 - C2 -2HUW 8.5 GRB2_HUMAN
48 PsiBlast_CBE 94.81100%-143 - C2 -1ZFP 8.1 GRB2_HUMAN
9 PsiBlast_PDB 94.64100%-141 - C2 -3IN8 8.1 GRB2_HUMAN
24 PsiBlast_CBE 94.57100%-151 - C2 -3N84 2.7 GRB2_HUMAN
11 PsiBlast_PDB 94.46100%-140 - C2 -3N8M 7.6 GRB2_HUMAN
6 PsiBlast_PDB 94.37100%-135 - C2 -3IMD 7.1 GRB2_HUMAN
51 PsiBlast_CBE 94.33100%-144 - C2 -3N7Y 7.1 GRB2_HUMAN
15 PsiBlast_PDB 94.32100%-135 - C2 -3S8O 8.3 GRB2_HUMAN
258 HHSearch 94.24100%-143 - C2 -3WA4 8.3 GRB2_HUMAN
49 PsiBlast_CBE 94.24100%-143 - C2 -3WA4 8.3 GRB2_HUMAN
39 PsiBlast_CBE 94.20100%-142 - C2 -1JYQ 8.2 GRB2_HUMAN
41 PsiBlast_CBE 94.08100%-136 - C2 -1QG1 5.6 GRB2_HUMAN
38 PsiBlast_CBE 94.08100%-145 - C2 -1JYQ 9.2 GRB2_HUMAN
23 PsiBlast_CBE 94.07100%-153 - C2 -3N84 8.0 GRB2_HUMAN
22 PsiBlast_CBE 94.03100%-150 - C2 -3N84 8.4 GRB2_HUMAN
2 PsiBlast_PDB 93.81100%-156 - C2 -3N84 2.7 GRB2_HUMAN
21 PsiBlast_CBE 93.75100%-146 - C2 -3N84 8.3 GRB2_HUMAN
54 PsiBlast_CBE 93.61100%-147 - C2 -3MXY 6.7 GRB2_HUMAN
55 PsiBlast_CBE 93.51100%-145 - C2 -3MXC 7.5 GRB2_HUMAN
25 PsiBlast_CBE 93.28100%-150 - C2 -3N84 8.6 GRB2_HUMAN
65 PsiBlast_CBE 92.97100%-132 - C2 -1CJ1 7.8 GRB2_HUMAN
50 PsiBlast_CBE 92.86100%-140 - C2 -3N7Y 7.7 GRB2_HUMAN
52 PsiBlast_CBE 92.85100%-134 - C2 -3N7Y 6.7 GRB2_HUMAN
66 PsiBlast_CBE 92.54100%-130 - C2 -1CJ1 7.8 GRB2_HUMAN
10 PsiBlast_PDB 92.47100%-134 - C2 -3KFJ 7.1 GRB2_HUMAN
60 PsiBlast_CBE 92.08100%-130 - C2 -1CJ1 8.0 GRB2_HUMAN
64 PsiBlast_CBE 91.80100%-130 - C2 -1CJ1 7.9 GRB2_HUMAN
57 PsiBlast_CBE 91.79100%-132 - C2 -1CJ1 7.9 GRB2_HUMAN
58 PsiBlast_CBE 91.76100%-132 - C2 -1CJ1 7.9 GRB2_HUMAN
63 PsiBlast_CBE 91.69100%-132 - C2 -1CJ1 7.7 GRB2_HUMAN
67 PsiBlast_CBE 91.09100%-130 - C2 -1CJ1 7.9 GRB2_HUMAN
40 PsiBlast_CBE 90.99100%-137 - C2 -1X0N 8.3 GRB2_HUMAN
59 PsiBlast_CBE 90.96100%-132 - C2 -1CJ1 7.6 GRB2_HUMAN
61 PsiBlast_CBE 90.79100%-132 - C2 -1CJ1 7.7 GRB2_HUMAN
62 PsiBlast_CBE 90.63100%-130 - C2 -1CJ1 7.8 GRB2_HUMAN
5 PsiBlast_PDB 86.86100% -97 - C2 -1FYR 8.3 GRB2_HUMAN
47 PsiBlast_CBE 85.90100%-118 - C2 -2AOA 9.3 GRB2_HUMAN
36 PsiBlast_CBE 85.76100% -82 - C2 -2H5K 7.1 GRB2_HUMAN
43 PsiBlast_CBE 85.50100%-112 - C2 -2AOB 9.8 GRB2_HUMAN
27 PsiBlast_CBE 85.00100%-102 - C2 -1FYR 7.3 GRB2_HUMAN
26 PsiBlast_CBE 84.60100% -97 - C2 -1FYR 7.5 GRB2_HUMAN
28 PsiBlast_CBE 84.52100% -97 - C2 -1FYR 7.2 GRB2_HUMAN
20 PsiBlast_PDB 84.34100% -96 - C2 -2H46 2.2 GRB2_HUMAN
45 PsiBlast_CBE 84.26100%-107 - C2 -2AOB 10.3 GRB2_HUMAN
74 PsiBlast_CBE 81.9155%-138 - C2 -1R1Q 7.8 GRAP2_MOUSE
78 PsiBlast_CBE 81.5455%-141 - C2 -1R1P 8.2 GRAP2_MOUSE
42 PsiBlast_CBE 81.26100% -93 - C2 -2AOB 3.3 GRB2_HUMAN
44 PsiBlast_CBE 81.00100%-101 - C2 -2AOB 3.2 GRB2_HUMAN
72 PsiBlast_CBE 80.7755%-135 - C2 -1R1S 7.5 GRAP2_MOUSE
75 PsiBlast_CBE 80.6755%-146 - C2 -1R1Q 8.9 GRAP2_MOUSE
275 Fugue 80.45100% 65 - C2 -1ZFP 8.1 GRB2_HUMAN
77 PsiBlast_CBE 79.9755%-131 - C2 -1R1P 8.2 GRAP2_MOUSE
76 PsiBlast_CBE 79.3455%-146 - C2 -1R1P 7.8 GRAP2_MOUSE
73 PsiBlast_CBE 79.2255%-139 - C2 -1R1S 7.9 GRAP2_MOUSE
265 HHSearch 79.0656%-139 - C2 -1R1P 8.0 GRAP2_MOUSE
79 PsiBlast_CBE 78.8355%-139 - C2 -1R1P 8.0 GRAP2_MOUSE
71 PsiBlast_CBE 77.2355%-140 - C2 -1R1S 7.7 GRAP2_MOUSE
70 PsiBlast_CBE 77.2155%-138 - C2 -1R1S 7.5 GRAP2_MOUSE
69 PsiBlast_CBE 74.5696% -74 - C2 -4JMG 7.0 ?
68 PsiBlast_CBE 73.1396% -78 - C2 -4JMH 8.5 ?
46 PsiBlast_CBE 71.28100%-115 - C2 -2AOA 4.9 GRB2_HUMAN
274 HHSearch 68.6540% -99 - C2 -5DC4 2.0