@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B2R7X4_HUMAN: (2017-06-01 )
CFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFY

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MLA_A_13(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_D_21(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_C_18(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_E_24(5EEL)
GRB7_HUMAN
[Raw transfer]




CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_L_5(3PQZ)

[Raw transfer]

-

FMT_E_25(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_A_3(4WWQ)
GRB7_HUMAN
[Raw transfer]




FMT_B_16(5EEL)
GRB7_HUMAN
[Raw transfer]




CHAIN_B_2(1MW4)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_B_2(2L4K)

[Raw transfer]

-

209 HHSearch 95.0399%-193 - C3 -2AUG - GRB14_HUMAN -
1 PsiBlast_PDB 93.75100%-180 - C3 -2AUG - GRB14_HUMAN -
210 HHSearch 86.7363%-199 - C3 -3PQZ 2.9 GRB7_HUMAN
26 PsiBlast_CBE 85.0464%-174 - C3 -5EEL 3.5 GRB7_HUMAN
4 PsiBlast_PDB 84.7164%-186 - C3 -3PQZ 2.9 GRB7_HUMAN
29 PsiBlast_CBE 84.0364%-177 - C3 -5EEL 2.9 GRB7_HUMAN
9 PsiBlast_PDB 83.6064%-179 - C3 -5D0J - GRB7_HUMAN -
8 PsiBlast_PDB 82.7164%-182 - C3 -4WWQ 3.0 GRB7_HUMAN
212 HHSearch 82.4468%-200 - C3 -1NRV - GRB10_HUMAN -
27 PsiBlast_CBE 82.1564%-168 - C3 -5EEL 4.3 GRB7_HUMAN
23 PsiBlast_CBE 81.7264%-180 - C3 -3PQZ 7.0 GRB7_HUMAN
11 PsiBlast_PDB 81.1664%-169 - C3 -5EEQ - GRB7_HUMAN -
10 PsiBlast_PDB 81.1064%-174 - C3 -5EEL 4.4 GRB7_HUMAN
3 PsiBlast_PDB 80.7969%-186 - C3 -1NRV - GRB10_HUMAN -
6 PsiBlast_PDB 80.6764%-176 - C3 -2QMS - GRB7_HUMAN -
22 PsiBlast_CBE 80.4164%-167 - C3 -3PQZ 2.1 GRB7_HUMAN
21 PsiBlast_CBE 79.3064%-165 - C3 -3PQZ 2.3
28 PsiBlast_CBE 78.6364%-175 - C3 -5EEL 4.2 GRB7_HUMAN
12 PsiBlast_PDB 78.1964%-160 - C3 -4X6S - GRB7_HUMAN -
2 PsiBlast_PDB 72.5569% - - C3 -3M7F - GRB10_MOUSE -
5 PsiBlast_PDB 58.2864% -91 - C3 -1MW4 2.8
7 PsiBlast_PDB 54.1264% -69 - C3 -2L4K 7.8