@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B3GUD3_HUMAN: (2017-06-01 )
WFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHY

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PHS_Q_6(1AYA)
PTN11_MOUSE
[Raw transfer]




PHS_P_5(1AYA)
PTN11_MOUSE
[Raw transfer]




GOL_A_9(4H34)
PTN11_HUMAN
[Raw transfer]




CHAIN_B_2(1JU5)
CRK_HUMAN
[Raw transfer]

-

CHAIN_B_2(3TL0)
PTN11_HUMAN
[Raw transfer]

-

CHAIN_P_2(1AYA)
PTN11_MOUSE
[Raw transfer]

-

CHAIN_Q_4(1AYA)
PTN11_MOUSE
[Raw transfer]

-

CHAIN_P_2(1AYB)
PTN11_MOUSE
[Raw transfer]

-

CHAIN_B_2(2YU7)

[Raw transfer]

-

CHAIN_P_2(1AYC)
PTN11_MOUSE
[Raw transfer]

-

CHAIN_Q_3(3TKZ)
PTN11_HUMAN
[Raw transfer]

-

CHAIN_B_2(2RMX)

[Raw transfer]

-

13 PsiBlast_PDB 88.65100%-100 - C1 -4OHI Calc... PTN11_HUMAN
21 PsiBlast_CBE 88.58100%-168 - C1 -5EHR Calc... PTN11_HUMAN
2 PsiBlast_PDB 88.36100%-131 - C1 -2SHP Calc... PTN11_HUMAN
12 PsiBlast_PDB 87.86100% -96 - C1 -4DGP Calc... PTN11_HUMAN
8 PsiBlast_PDB 87.41100%-138 - C1 -5I6V Calc... PTN11_HUMAN
7 PsiBlast_PDB 87.21100%-126 - C1 -4OHH Calc... ?
1 PsiBlast_PDB 87.05100%-147 - C1 -5IBS Calc... PTN11_HUMAN
15 PsiBlast_PDB 86.95100%-153 - C1 -4OHL Calc... PTN11_HUMAN
17 PsiBlast_PDB 86.88100%-118 - C1 -5DF6 Calc...
3 PsiBlast_PDB 86.53100%-152 - C1 -5EHP Calc... PTN11_HUMAN
4 PsiBlast_PDB 86.31100%-147 - C1 -4NWF Calc... PTN11_HUMAN
16 PsiBlast_PDB 86.00100%-156 - C1 -4H1O Calc... PTN11_HUMAN
11 PsiBlast_PDB 85.85100%-129 - C1 -4OHD Calc... PTN11_HUMAN
14 PsiBlast_PDB 85.75100% -97 - C1 -4DGX Calc... PTN11_HUMAN
5 PsiBlast_PDB 85.30100%-149 - C1 -5IBM Calc... PTN11_HUMAN
6 PsiBlast_PDB 85.22100%-142 - C1 -4OHE Calc... PTN11_HUMAN
10 PsiBlast_PDB 84.35100%-160 - C1 -4H34 2.8 PTN11_HUMAN
9 PsiBlast_PDB 83.98100%-135 - C1 -4GWF Calc... PTN11_HUMAN
18 PsiBlast_PDB 82.3598%-152 - C1 -4NWG Calc... PTN11_HUMAN
19 PsiBlast_PDB 80.95100%-106 - C1 -4JEG Calc... PTN11_HUMAN
32 PsiBlast_CBE 65.9845%-129 - C1 -1AYA 4.2 PTN11_MOUSE
30 PsiBlast_CBE 65.9745%-136 - C1 -1AYC 5.6 PTN11_MOUSE
33 PsiBlast_CBE 65.5745%-138 - C1 -1AYA 4.3 PTN11_MOUSE
35 PsiBlast_CBE 65.2745%-128 - C1 -3TKZ 1.6 PTN11_HUMAN
27 PsiBlast_CBE 65.1255% -16 - C1 -2YU7 3.5
34 PsiBlast_CBE 64.9745%-140 - C1 -3TL0 6.5 PTN11_HUMAN
31 PsiBlast_CBE 63.8845%-140 - C1 -1AYB 5.7 PTN11_MOUSE
28 PsiBlast_CBE 62.6355% -18 - C1 -2RMX 3.3
288 HHSearch 60.3745% -77 - C1 -1JU5 3.1 CRK_HUMAN