@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B3GUD5_HUMAN: (2017-06-01 )
WFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PHS_Q_6(1AYA)
PTN11_MOUSE
[Raw transfer]




PHS_P_5(1AYA)
PTN11_MOUSE
[Raw transfer]




EDO_A_2(4H34)
PTN11_HUMAN
[Raw transfer]




CHAIN_P_2(1AYA)
PTN11_MOUSE
[Raw transfer]

-

CHAIN_P_2(1AYB)
PTN11_MOUSE
[Raw transfer]

-

CHAIN_P_2(1AYC)
PTN11_MOUSE
[Raw transfer]

-

CHAIN_Q_3(3TKZ)
PTN11_HUMAN
[Raw transfer]

-

CHAIN_B_2(3TL0)
PTN11_HUMAN
[Raw transfer]

-

CHAIN_Q_4(1AYA)
PTN11_MOUSE
[Raw transfer]

-

CHAIN_B_2(3WA4)
GRB2_HUMAN
[Raw transfer]

-

21 PsiBlast_CBE 97.06100% 0 - C- -4NWG - PTN11_HUMAN -
2 PsiBlast_PDB 93.44100%-155 - C1 -4GWF Calc... PTN11_HUMAN
30 PsiBlast_CBE 93.17100%-127 - C1 -1AYC 6.5 PTN11_MOUSE
13 PsiBlast_PDB 92.45100%-132 - C1 -5EHR Calc... PTN11_HUMAN
19 PsiBlast_PDB 91.59100%-121 - C1 -5DF6 Calc...
14 PsiBlast_PDB 91.57100%-134 - C1 -5EHP Calc... PTN11_HUMAN
24 PsiBlast_CBE 91.33100%-133 - C1 -5I6V Calc... PTN11_HUMAN
4 PsiBlast_PDB 90.89100%-142 - C1 -4OHL Calc... PTN11_HUMAN
31 PsiBlast_CBE 90.55100%-123 - C1 -1AYB 5.9 PTN11_MOUSE
33 PsiBlast_CBE 90.36100%-127 - C1 -1AYA 4.4 PTN11_MOUSE
28 PsiBlast_CBE 90.28100%-126 - C1 -3TL0 7.3 PTN11_HUMAN
15 PsiBlast_PDB 90.25100%-124 - C1 -4H34 3.0 PTN11_HUMAN
32 PsiBlast_CBE 89.95100%-118 - C1 -1AYA 3.5 PTN11_MOUSE
6 PsiBlast_PDB 89.38100%-140 - C1 -4NWG Calc... PTN11_HUMAN
3 PsiBlast_PDB 89.33100%-125 - C1 -4OHE Calc... PTN11_HUMAN
23 PsiBlast_CBE 89.28100%-125 - C1 -4GWF Calc... PTN11_HUMAN
8 PsiBlast_PDB 89.19100%-133 - C1 -4OHI Calc... PTN11_HUMAN
18 PsiBlast_PDB 89.1198%-130 - C1 -4H1O Calc... PTN11_HUMAN
9 PsiBlast_PDB 89.11100%-123 - C- -4OHH - ? -
29 PsiBlast_CBE 88.99100%-118 - C1 -3TKZ 2.1 PTN11_HUMAN
270 HHSearch 58.5143% -77 - C1 -3WA4 5.3 GRB2_HUMAN