@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B3KWE9_HUMAN: (2017-06-01 )
CYHGKLSRKAAESLLVKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(1TCE)

[Raw transfer]
-
CHAIN_B_2(1JU5)
CRK_HUMAN
[Raw transfer]
-
2 PsiBlast_PDB 84.5273%-133 - C1 -1TCE 3.4
228 HHSearch 83.5474%-122 - C- -1MIL - -
1 PsiBlast_PDB 79.5774%-107 - C- -1MIL - -
227 HHSearch 68.0343%-138 - C1 -2KK6 Calc...
4 PsiBlast_PDB 68.0343%-138 - C1 -2KK6 - -
236 HHSearch 67.6837%-166 - C1 -1WQU Calc...
225 HHSearch 64.8839% 3 - C1 -1JU5 2.4 CRK_HUMAN
11 PsiBlast_PDB 64.2736% 25 - C1 -3WA4 - GRB2_HUMAN -
80 PsiBlast_CBE 63.7138% 19 - C1 -5DC4 - -
6 PsiBlast_PDB 63.3641% 5 - C1 -4EIH - -
56 PsiBlast_CBE 62.7336% 28 - C1 -3IN7 - GRB2_HUMAN -
79 PsiBlast_CBE 62.3638% 20 - C1 -5DC9 - -
52 PsiBlast_CBE 62.2136% 25 - C1 -3OV1 - GRB2_HUMAN -
22 PsiBlast_CBE 62.2036% 27 - C1 -1JYQ - GRB2_HUMAN -
7 PsiBlast_PDB 62.1138% 25 - C1 -1OPK - ABL1_MOUSE -
231 HHSearch 61.9735% 24 * C1 *3WA4 Calc... GRB2_HUMAN
48 PsiBlast_CBE 61.9736% 33 - C1 -3S8O - GRB2_HUMAN -
12 PsiBlast_PDB 61.9636% 25 - C1 -1JYQ - GRB2_HUMAN -
47 PsiBlast_CBE 61.8036% 32 - C1 -4P9V - GRB2_HUMAN -
78 PsiBlast_CBE 61.5336% 20 - C1 -3MXC - GRB2_HUMAN -