@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B4E0E2_HUMAN: (2017-06-01 )
FFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




CHAIN_B_2(2OQ1)
ZAP70_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_J_10(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1JU5)
CRK_HUMAN
[Raw transfer]

-

4 PsiBlast_PDB 93.21100%-197 - C6 -4XZ0 Calc... ZAP70_HUMAN
3 PsiBlast_PDB 91.87100%-200 - C6 -4XZ1 Calc... ZAP70_HUMAN
1 PsiBlast_PDB 90.36100%-204 - C6 -4K2R Calc... ZAP70_HUMAN
5 PsiBlast_PDB 90.26100%-198 - C6 -1M61 Calc... ZAP70_HUMAN
6 PsiBlast_PDB 89.1198%-191 - C6 -2OQ1 5.1 ZAP70_HUMAN
123 HHSearch 87.49100%-186 - C6 -2OZO Calc... ZAP70_HUMAN
2 PsiBlast_PDB 87.49100%-186 - C6 -2OZO - ZAP70_HUMAN -
8 PsiBlast_PDB 71.7956%-160 - C6 -4FL2 Calc... KSYK_HUMAN
134 HHSearch 69.8456%-166 - C6 -4FL3 Calc... KSYK_HUMAN
7 PsiBlast_PDB 69.8456%-166 - C6 -4FL3 - KSYK_HUMAN -
22 PsiBlast_CBE 69.8256%-169 - C6 -1A81 3.5 KSYK_HUMAN
9 PsiBlast_PDB 68.3156%-155 - C6 -1A81 4.0 KSYK_HUMAN
25 PsiBlast_CBE 67.2456%-157 - C6 -1A81 2.6 KSYK_HUMAN
128 HHSearch 64.9928%-189 - C6 -4EIH Calc...
136 HHSearch 63.2733%-189 - C6 -2EO3 Calc... CRKL_HUMAN
24 PsiBlast_CBE 59.6656% 0 - C- -1A81 - KSYK_HUMAN -
23 PsiBlast_CBE 59.6656% 0 - C- -1A81 - KSYK_HUMAN -
21 PsiBlast_CBE 59.6656% 0 - C- -1A81 - KSYK_HUMAN -
137 HHSearch 58.2528%-166 - C6 -1OPK Calc... ABL1_MOUSE
39 PsiBlast_CBE 58.1235%-190 - C6 -2ROR - -
124 HHSearch 54.1635%-110 - C6 -1JU5 4.0 CRK_HUMAN