@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B5MDS8_HUMAN: (2017-06-01 )
WYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_P_2(2VIF)
KIT_HUMAN
[Raw transfer]
-
CHAIN_P_2(2VIF)
KIT_HUMAN
[Raw transfer]
-
1 PsiBlast_PDB 79.0863% -41 - C3 -2VIF 6.6 KIT_HUMAN
187 HHSearch 76.7160% -39 - C3 -2VIF 5.5 KIT_HUMAN
170 HHSearch 70.4443% -73 - C3 -2IZV - -
184 HHSearch 69.6527% -56 - C3 -2CRH - -
5 PsiBlast_PDB 68.8644% -60 - C3 -2IZV - -
2 PsiBlast_PDB 66.7442% -56 - C3 -2C9W - SOCS2_HUMAN -
22 PsiBlast_CBE 66.1037% -68 - C3 -4GL9 - SOCS3_MOUSE -
181 HHSearch 64.9728% -92 - C3 -1K9A - CSK_RAT -
4 PsiBlast_PDB 64.3142% -48 - C3 -4JGH - SOCS2_HUMAN -
6 PsiBlast_PDB 63.8537% -70 - C3 -4GL9 - SOCS3_MOUSE -
169 HHSearch 63.1139% 0 - C- -2C9W - SOCS2_HUMAN -
189 Fugue 62.3038% -7 - C3 -2IZV - -
175 HHSearch 61.9030% -89 - C- -3EAZ - CSK_HUMAN -
21 PsiBlast_CBE 61.2937% -54 - C3 -4GL9 - SOCS3_MOUSE -
13 PsiBlast_PDB 61.1241% -77 - C3 -2ECD - -
23 PsiBlast_CBE 60.7637% -55 - C3 -4GL9 - SOCS3_MOUSE -
178 HHSearch 59.7331% -10 - C3 -2IUG - -
50 PsiBlast_CBE 59.4135% -36 - C3 -4K45 - PLCG1_RAT -
33 PsiBlast_CBE 59.0339% -55 - C3 -5DC9 - -
10 PsiBlast_PDB 58.7735% -68 - C3 -2RVF - ? -