@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B7Z2N8_HUMAN: (2017-06-01 )
FHFREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(2IUH)
KIT_HUMAN
[Raw transfer]

-

CHAIN_C_3(2IUI)
P85A_HUMAN
[Raw transfer]

-

CHAIN_D_4(2IUI)

[Raw transfer]

-

CHAIN_B_2(1FU5)

[Raw transfer]

-

6 PsiBlast_PDB 90.27100%-100 - C5 -2IUH 9.0 KIT_HUMAN
7 PsiBlast_PDB 89.50100%-106 - C5 -2IUI 6.9 P85A_HUMAN
178 HHSearch 89.3197% -90 - C5 -2IUG Calc...
2 PsiBlast_PDB 89.29100% -97 - C5 -4L1B Calc...
5 PsiBlast_PDB 89.13100% -95 - C5 -2IUG - -
4 PsiBlast_PDB 89.13100% -98 - C5 -4L2Y Calc...
3 PsiBlast_PDB 88.97100% -98 - C5 -4L23 Calc...
14 PsiBlast_PDB 88.51100%-109 - C5 -3HHM Calc...
21 PsiBlast_CBE 88.48100%-101 - C5 -2IUI 6.9
193 HHSearch 87.6397%-105 - C5 -3HHM - -
15 PsiBlast_PDB 86.44100%-114 - C5 -3HIZ Calc... P85A_HUMAN
11 PsiBlast_PDB 86.29100%-113 - C5 -5FI4 Calc...
18 PsiBlast_PDB 85.03100% - - C5 -4OVU Calc... P85A_HUMAN
10 PsiBlast_PDB 80.46100%-157 - C5 -4WAF Calc...
13 PsiBlast_PDB 78.45100% 0 - C- -4ZOP - -
8 PsiBlast_PDB 77.2698% -66 - C5 -2PNA Calc...
9 PsiBlast_PDB 76.4698% -49 - C5 -2PNB Calc...
19 PsiBlast_PDB 73.82100% 0 - C- -4OVV - -
12 PsiBlast_PDB 73.13100%-120 - C5 -5ITD Calc...
17 PsiBlast_PDB 70.7797% -79 - C5 -1FU6 Calc...
16 PsiBlast_PDB 59.5397% -23 - C5 -1FU5 0.5