@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B7Z629_HUMAN: (2017-06-01 )
WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVMNKTATGYGFAEPYNLYSSLKELVLHY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(1PIC)

[Raw transfer]
-
GOL_A_3(5AUL)

[Raw transfer]



CHAIN_B_2(1H9O)

[Raw transfer]
-
ACE_B_3(1PIC)

[Raw transfer]
261 HHSearch 90.9799%-117 - C3 -5AUL 2.4
6 PsiBlast_PDB 90.4897%-117 - C3 -5AUL - -
3 PsiBlast_PDB 88.3098%-119 - C3 -1H9O 6.0
1 PsiBlast_PDB 83.9498%-132 - C3 -1BFI Calc...
2 PsiBlast_PDB 82.7098%-125 - C3 -1BFJ Calc...
5 PsiBlast_PDB 82.4598% - - C3 -1QAD Calc...
258 HHSearch 82.4176%-131 - C3 -2Y3A Calc...
7 PsiBlast_PDB 82.4176%-131 - C3 -2Y3A - -
4 PsiBlast_PDB 81.0098%-113 - C3 -1PIC 4.3
30 PsiBlast_CBE 67.8035% -43 - C3 -2IUI - P85A_HUMAN -
31 PsiBlast_CBE 67.5435% -51 - C3 -2IUH - KIT_HUMAN -
29 PsiBlast_CBE 67.2235% -46 - C3 -2IUI - -
271 HHSearch 63.8934% -50 - C3 -2IUG Calc...
275 HHSearch 61.0735% -50 - C3 -4L23 Calc...
12 PsiBlast_PDB 57.6836% -68 - C3 -5DC0 - ABL1_HUMAN -
15 PsiBlast_PDB 57.4536% -59 - C3 -5DC4 - -
44 PsiBlast_CBE 57.2731% -57 - C3 -2LNW - -
259 HHSearch 56.8634% -83 - C3 -1JU5 Calc... CRK_HUMAN
260 HHSearch 56.8340% -91 - C3 -4EIH Calc...
14 PsiBlast_PDB 56.7236% -64 - C3 -3UYO - -