@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B7Z7F9_HUMAN: (2017-06-01 )
WFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFY

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




MLA_D_21(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_C_18(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_E_24(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_A_13(5EEL)
GRB7_HUMAN
[Raw transfer]




FMT_E_25(5EEL)
GRB7_HUMAN
[Raw transfer]




CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_L_5(3PQZ)

[Raw transfer]

-

MLA_A_3(4WWQ)
GRB7_HUMAN
[Raw transfer]




FMT_B_16(5EEL)
GRB7_HUMAN
[Raw transfer]




CHAIN_B_2(1MW4)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_B_2(2L4K)

[Raw transfer]

-

227 HHSearch 93.96100%-190 - C2 -2AUG - GRB14_HUMAN -
1 PsiBlast_PDB 93.96100%-190 - C2 -2AUG - GRB14_HUMAN -
228 HHSearch 86.0065%-195 - C2 -3PQZ 2.9 GRB7_HUMAN
11 PsiBlast_PDB 85.7764%-195 - C2 -3PQZ 2.9 GRB7_HUMAN
23 PsiBlast_CBE 85.5164%-184 - C2 -5EEL 3.5 GRB7_HUMAN
26 PsiBlast_CBE 84.3064%-187 - C2 -5EEL 2.9 GRB7_HUMAN
24 PsiBlast_CBE 84.1364%-178 - C2 -5EEL 4.3 GRB7_HUMAN
8 PsiBlast_PDB 84.0164%-187 - C2 -5D0J - GRB7_HUMAN -
7 PsiBlast_PDB 82.3764%-191 - C2 -4WWQ 3.0 GRB7_HUMAN
9 PsiBlast_PDB 82.0764%-183 - C2 -5EEL 4.4 GRB7_HUMAN
10 PsiBlast_PDB 81.9564%-178 - C2 -5EEQ - GRB7_HUMAN -
229 HHSearch 81.8570%-197 - C2 -1NRV - GRB10_HUMAN -
3 PsiBlast_PDB 81.6469%-197 - C2 -1NRV - GRB10_HUMAN -
33 PsiBlast_CBE 81.3564%-189 - C2 -3PQZ 7.0 GRB7_HUMAN
32 PsiBlast_CBE 81.3564%-177 - C2 -3PQZ 2.1 GRB7_HUMAN
5 PsiBlast_PDB 80.9864%-185 - C2 -2QMS - GRB7_HUMAN -
25 PsiBlast_CBE 78.6864%-183 - C2 -5EEL 4.2 GRB7_HUMAN
31 PsiBlast_CBE 78.6464%-176 - C2 -3PQZ 2.3
12 PsiBlast_PDB 77.9164%-170 - C2 -4X6S - GRB7_HUMAN -
242 HHSearch 71.0031%-179 - C2 -1I3Z - SH21B_MOUSE -
243 HHSearch 60.3435% -50 - C2 -1LKK Error LCK_HUMAN
4 PsiBlast_PDB 56.3664% -96 - C2 -1MW4 2.8
6 PsiBlast_PDB 51.1764% -75 - C2 -2L4K 7.8