@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : DAPP1_HUMAN: (2017-06-02 )
WYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHF

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




ACE_I_3(1BHF)

[Raw transfer]




PHS_B_3(1LCJ)
LCK_HUMAN
[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




PHS_B_3(1LCK)
LCK_HUMAN
[Raw transfer]




ACE_C_5(1A08)
SRC_HUMAN
[Raw transfer]




ACE_C_5(1A07)
SRC_HUMAN
[Raw transfer]




ACE_D_6(1A07)

[Raw transfer]




ACE_D_6(1A08)

[Raw transfer]




ACE_C_5(1A09)
SRC_HUMAN
[Raw transfer]




2 PsiBlast_PDB 90.8838%-157 - C2 -4K45 - PLCG1_RAT -
296 HHSearch 89.3838%-161 - C2 -4K45 - PLCG1_RAT -
3 PsiBlast_PDB 88.7238%-147 - C2 -5EG3 - ? -
5 PsiBlast_PDB 85.4138%-137 - C2 -2PLD - -
292 HHSearch 84.2837%-102 - C2 -1D4T - SH21A_HUMAN -
27 PsiBlast_CBE 84.1539% 0 - C- -4NWG - PTN11_HUMAN -
281 HHSearch 83.1236%-119 - C2 -2CIA - -
10 PsiBlast_PDB 83.1236%-119 - C2 -2CIA - -
284 HHSearch 82.7537% -90 - C2 -1KA6 - SH21A_HUMAN -
12 PsiBlast_PDB 81.8939% -74 - C2 -1AYB - PTN11_MOUSE -
21 PsiBlast_CBE 81.7036%-109 - C2 -2CI9 - -
13 PsiBlast_PDB 81.3739% -74 - C2 -1AYC - PTN11_MOUSE -
8 PsiBlast_PDB 81.2036%-112 - C2 -2CI9 - NCK1_HUMAN -
288 HHSearch 80.7433%-113 - C2 -1I3Z - SH21B_MOUSE -
11 PsiBlast_PDB 80.3939% -72 - C2 -1AYA - PTN11_MOUSE -
6 PsiBlast_PDB 79.9938%-122 - C2 -2PLE - -
22 PsiBlast_CBE 79.9539% -65 - C2 -1AYA - PTN11_MOUSE -
15 PsiBlast_PDB 79.8839% -75 - C2 -4JE4 - PTN11_HUMAN -
4 PsiBlast_PDB 79.1938%-118 - C2 -2FCI - -
26 PsiBlast_CBE 79.0439% -67 - C2 -4H34 - PTN11_HUMAN -
263 PsiBlast_CBE 72.4536% -26 - C2 -1LKK Error LCK_HUMAN
274 PsiBlast_CBE 71.4833% -38 - C2 -1A07 3.3
262 PsiBlast_CBE 71.4136% -28 - C2 -1BHF Error
264 PsiBlast_CBE 70.7836% -19 - C2 -1LKL 3.7 ?
261 PsiBlast_CBE 69.8636% -16 - C2 -1LCJ 3.4 LCK_HUMAN
273 PsiBlast_CBE 69.7633% -25 - C2 -1A08 3.4 SRC_HUMAN
275 PsiBlast_CBE 69.4833% -41 - C2 -1A07 3.3 SRC_HUMAN
272 PsiBlast_CBE 69.1533% -26 - C2 -1A08 3.4
256 PsiBlast_CBE 68.5836% -11 - C2 -1LCK 3.8 LCK_HUMAN
271 PsiBlast_CBE 68.0333% -27 - C2 -1A09 3.4 SRC_HUMAN