@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : E5RFS5_HUMAN: (2017-06-02 )
WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHY

Atome Classification :

(89 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_A_4(1HCS)

[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




687_B_2(1O45)

[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




821_B_2(1O43)

[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




PTC_C_5(1IS0)
SRC_RSVSA
[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




853_A_2(1O48)

[Raw transfer]




PTC_D_6(1IS0)

[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




903_B_2(1O46)

[Raw transfer]




300_B_2(1O41)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

CHAIN_D_2(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1SHD)

[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

CHAIN_B_2(1F1W)

[Raw transfer]

-

CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

ACE_C_5(1A1A)
SRC_HUMAN
[Raw transfer]




CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_C_3(1NZL)

[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

5 PsiBlast_PDB 93.15100% -92 - C2 -2MRJ Calc... FYN_HUMAN
258 HHSearch 90.32100% -96 - C2 -4U1P Calc... FYN_HUMAN
1 PsiBlast_PDB 90.32100% -96 - C2 -4U1P - FYN_HUMAN -
8 PsiBlast_PDB 87.91100% -90 - C2 -2MRK Calc... FYN_HUMAN
9 PsiBlast_PDB 87.8098% -95 - C2 -3UF4 Calc... FYN_MOUSE
6 PsiBlast_PDB 86.85100% -91 - C2 -2MQI Calc... FYN_HUMAN
4 PsiBlast_PDB 86.73100%-108 - C2 -1G83 Calc... FYN_HUMAN
3 PsiBlast_PDB 83.62100% -92 - C2 -1AOU 4.7
2 PsiBlast_PDB 82.31100% -81 - C2 -1AOT 1.8
63 PsiBlast_CBE 79.2068%-132 - C2 -1NZV 6.0
126 PsiBlast_CBE 77.9362%-126 - C2 -1X27 6.0 ?
133 PsiBlast_CBE 77.9261%-126 - C2 -1IJR 8.2 LCK_HUMAN
65 PsiBlast_CBE 77.8468%-130 - C2 -1NZL 6.7
71 PsiBlast_CBE 77.4868%-123 - C2 -1SHB 3.8
69 PsiBlast_CBE 77.2468%-116 - C2 -1SPS 5.0 SRC_RSVSA
127 PsiBlast_CBE 76.7162%-117 - C2 -1X27 3.7 ?
57 PsiBlast_CBE 76.6368%-122 - C2 -1IS0 4.1
134 PsiBlast_CBE 76.6261%-132 - C2 -1FBZ 6.6 ?
42 PsiBlast_CBE 76.5168%-127 - C2 -1A1E 6.3 SRC_HUMAN
264 HHSearch 76.4663%-107 - C2 -4D8K Calc...
58 PsiBlast_CBE 76.4368%-128 - C2 -1IS0 4.7 SRC_RSVSA
135 PsiBlast_CBE 76.2461%-132 - C2 -1FBZ 6.8 LCK_HUMAN
52 PsiBlast_CBE 76.2468%-125 - C2 -1A07 3.8 SRC_HUMAN
61 PsiBlast_CBE 76.1468%-140 - C2 -1P13 5.4 SRC_CHICK
68 PsiBlast_CBE 76.0668%-134 - C2 -1SPS 4.5 SRC_RSVSA
72 PsiBlast_CBE 75.8968%-124 - C2 -1SHA 7.3
73 PsiBlast_CBE 75.8867%-129 - C2 -1BKM 6.7
48 PsiBlast_CBE 75.7468%-130 - C2 -1A09 5.7 SRC_HUMAN
40 PsiBlast_CBE 75.6368%-134 - C2 -1HCS 3.9
14 PsiBlast_PDB 75.5368%-117 - C2 -1O44 8.4
44 PsiBlast_CBE 75.4968%-116 - C2 -1A1C 6.5 SRC_HUMAN
132 PsiBlast_CBE 75.4762%-119 - C2 -1CWD 4.1 ?
10 PsiBlast_PDB 75.2769%-111 - C2 -1A1A 4.5 SRC_HUMAN
39 PsiBlast_CBE 75.2368%-114 - C2 -1HCT 2.9
38 PsiBlast_CBE 75.1868%-144 - C2 -1SHD 6.4
34 PsiBlast_CBE 75.1368%-121 - C2 -1O4H 3.7
124 PsiBlast_CBE 75.0162%-111 - C2 -1X27 5.5 ?
50 PsiBlast_CBE 74.9568%-116 - C2 -1A08 5.7 SRC_HUMAN
121 PsiBlast_CBE 74.8662%-106 - C2 -1LKL 3.9 ?
47 PsiBlast_CBE 74.8668%-125 - C2 -1A09 5.4
32 PsiBlast_CBE 74.7868%-121 - C2 -1O4J 2.8
125 PsiBlast_CBE 74.7462%-104 - C2 -1X27 4.5 ?
107 PsiBlast_CBE 74.6267%-122 - C2 -1F1W 6.1
67 PsiBlast_CBE 74.5368%-117 - C2 -1SPS 5.2
35 PsiBlast_CBE 74.5368%-124 - C2 -1O4E 3.4
128 PsiBlast_CBE 74.4162%-100 - C2 -1X27 5.9 ?
36 PsiBlast_CBE 74.3568%-120 - C2 -1O4D 2.4
118 PsiBlast_CBE 74.3162%-120 - C2 -1LCJ 4.6 LCK_HUMAN
46 PsiBlast_CBE 74.3168%-118 - C2 -1A1B 5.9 SRC_HUMAN
45 PsiBlast_CBE 74.2668%-124 - C2 -1A1B 5.9
31 PsiBlast_CBE 74.1768%-127 - C2 -1O4K 3.5
60 PsiBlast_CBE 74.0868%-134 - C2 -1P13 5.1
33 PsiBlast_CBE 74.0268%-127 - C2 -1O4I 2.4
51 PsiBlast_CBE 73.9868%-117 - C2 -1A07 3.5
23 PsiBlast_CBE 73.8669%-103 - C2 -1A1A 6.3
26 PsiBlast_CBE 73.8268%-113 - C2 -1O4P 5.2
122 PsiBlast_CBE 73.6162%-112 - C2 -1LCK 3.0 LCK_HUMAN
16 PsiBlast_PDB 73.5268%-117 - C2 -1O46 7.9
29 PsiBlast_CBE 73.4168%-122 - C2 -1O4M 3.1
11 PsiBlast_PDB 73.4068%-124 - C2 -1O41 2.7
24 PsiBlast_CBE 73.2268%-126 - C2 -1O4R 5.7
37 PsiBlast_CBE 73.0868%-110 - C2 -1O4B 5.9
30 PsiBlast_CBE 73.0068%-124 - C2 -1O4L 4.1
259 HHSearch 72.9263%-107 - C2 -1LKK 7.3 LCK_HUMAN
113 PsiBlast_CBE 72.9268%-124 - C2 -1O4F 2.5
28 PsiBlast_CBE 72.9168%-120 - C2 -1O4N 3.4
130 PsiBlast_CBE 72.8562%-133 - C2 -1CWE 5.2 ?
112 PsiBlast_CBE 72.8568%-118 - C2 -1O4G 3.8
12 PsiBlast_PDB 72.7768%-112 - C2 -1O42 7.4
117 PsiBlast_CBE 72.7165%-137 - C2 -1KC2 6.1
21 PsiBlast_CBE 72.71100% -38 - C2 -4U17 2.9 ?
120 PsiBlast_CBE 72.6862%-107 - C2 -1LKK 7.3 LCK_HUMAN
19 PsiBlast_PDB 72.6468%-111 - C2 -1O49 6.6
43 PsiBlast_CBE 72.5568%-120 - C2 -1A1C 7.0
7 PsiBlast_PDB 72.52100% -38 - C2 -4U17 2.3 FYN_HUMAN
25 PsiBlast_CBE 72.4968%-125 - C2 -1O4Q 3.5
41 PsiBlast_CBE 72.4668%-118 - C2 -1A1E 6.7
131 PsiBlast_CBE 72.3962%-123 - C2 -1CWE 5.1 ?
18 PsiBlast_PDB 72.3768%-114 - C2 -1O48 8.4
56 PsiBlast_CBE 72.2068%-131 - C2 -1SKJ 6.9
20 PsiBlast_PDB 72.0668%-114 - C2 -1O4A 7.1
15 PsiBlast_PDB 71.8968%-123 - C2 -1O45 7.3
129 PsiBlast_CBE 71.7262%-113 - C2 -1X27 4.0
27 PsiBlast_CBE 71.6368%-113 - C2 -1O4O 3.0
119 PsiBlast_CBE 71.4862%-115 - C2 -1BHF 4.9
49 PsiBlast_CBE 71.4168%-120 - C2 -1A08 6.4
13 PsiBlast_PDB 71.2968%-118 - C2 -1O43 6.4
17 PsiBlast_PDB 71.2368%-110 - C2 -1O47 7.9
275 Fugue 68.45100% 122 - C2 -1AOU 4.7