@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : E7EMU8_HUMAN: (2017-06-02 )
EMDPPAAEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(2IUH)
KIT_HUMAN
[Raw transfer]

-

CHAIN_C_3(2IUI)
P85A_HUMAN
[Raw transfer]

-

CHAIN_D_4(2IUI)

[Raw transfer]

-

9 PsiBlast_PDB 91.1986% -93 - C7 -2IUH 8.2 KIT_HUMAN
258 HHSearch 89.6286% -84 - C7 -2IUG Calc...
8 PsiBlast_PDB 89.6286% -84 - C7 -2IUG - -
10 PsiBlast_PDB 88.9286% -94 - C7 -2IUI 5.8 P85A_HUMAN
269 HHSearch 88.3186% -99 - C7 -3HHM Calc...
21 PsiBlast_CBE 87.6786% -88 - C7 -2IUI 6.0
20 PsiBlast_PDB 87.4391%-110 - C7 -4L23 Calc...
19 PsiBlast_PDB 86.6091%-111 - C7 -4L1B Calc...
13 PsiBlast_PDB 85.6991%-120 - C7 -3HHM - -
3 PsiBlast_PDB 85.5286%-104 - C7 -5FI4 Calc...
14 PsiBlast_PDB 85.4691%-130 - C7 -3HIZ Calc... P85A_HUMAN
2 PsiBlast_PDB 81.7586%-140 - C7 -4WAF Calc...
7 PsiBlast_PDB 80.3487% -33 - C7 -2PNB Calc...
6 PsiBlast_PDB 79.4587% -46 - C7 -2PNA Calc...
17 PsiBlast_PDB 79.4491% - - C7 -4OVU Calc... P85A_HUMAN
1 PsiBlast_PDB 78.7886% 0 - C- -4ZOP - -
12 PsiBlast_PDB 77.4686% -60 - C7 -1FU6 Calc...
4 PsiBlast_PDB 74.7586% -99 - C7 -5ITD Calc...
5 PsiBlast_PDB 69.4591%-164 - C7 -4YKN Calc... PK3CA_HUMAN
260 HHSearch 67.1528%-162 - C7 -3US4 Calc...