@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : E9PJX5_HUMAN: (2017-06-02 )
WFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHY

Atome Classification :

(90 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_I_3(1BHF)

[Raw transfer]




ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




687_B_2(1O45)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




853_A_2(1O48)

[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




PTC_C_5(1IS0)
SRC_RSVSA
[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




PHS_B_3(1LCJ)
LCK_HUMAN
[Raw transfer]




821_B_2(1O43)

[Raw transfer]




903_B_2(1O46)

[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




PTC_D_6(1IS0)

[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




300_B_2(1O41)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

ACE_B_3(1LKL)
?
[Raw transfer]




CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

CHAIN_B_2(1SHD)

[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

CHAIN_D_2(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1F1W)

[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_C_3(1NZL)

[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_P_2(1AOU)

[Raw transfer]

-

2 PsiBlast_PDB 82.0085%-129 - C1 -1BLK Calc...
259 HHSearch 78.8985%-130 - C1 -1BLJ Calc...
1 PsiBlast_PDB 78.8985%-130 - C1 -1BLJ - -
23 PsiBlast_CBE 74.1968% -34 - C1 -1X27 5.6 ?
10 PsiBlast_PDB 74.1668% -38 - C1 -1LKL 3.9 ?
14 PsiBlast_PDB 73.2467% -46 - C1 -1IJR 8.2 LCK_HUMAN
25 PsiBlast_CBE 73.0968% -40 - C1 -1X27 3.9 ?
26 PsiBlast_CBE 72.6768% -34 - C1 -1X27 6.0 ?
256 HHSearch 71.9868% - - C1 -4TZI Calc... LYN_MOUSE
11 PsiBlast_PDB 71.6868% -38 - C1 -1LKK 7.2 LCK_HUMAN
13 PsiBlast_PDB 71.4967% - - C1 -4TZI - LYN_MOUSE -
22 PsiBlast_CBE 71.3268% -43 - C1 -1X27 6.2 ?
73 PsiBlast_CBE 71.3055% -58 - C1 -1NZL Calc... SRC_RSVSA
260 HHSearch 70.8770% -38 - C1 -1LKK 7.2 LCK_HUMAN
24 PsiBlast_CBE 70.8368% -49 - C1 -1X27 5.9 ?
9 PsiBlast_PDB 70.4668% -36 - C1 -1X27 4.9
6 PsiBlast_PDB 70.0768% -46 - C1 -1BHF 4.9
71 PsiBlast_CBE 69.8655% -57 - C1 -1NZV Calc... SRC_RSVSA
5 PsiBlast_PDB 69.5368% -44 - C1 -1LCJ 4.8 LCK_HUMAN
12 PsiBlast_PDB 69.4968% -42 - C1 -4D8K Calc...
21 PsiBlast_CBE 69.3268% -43 - C1 -1CWE 5.4 ?
27 PsiBlast_CBE 67.9967% -54 - C1 -1FBZ 7.7 ?
15 PsiBlast_PDB 67.9167% -54 - C1 -1FBZ 7.5 LCK_HUMAN
8 PsiBlast_PDB 67.8568% -32 - C1 -1LCK 3.5 LCK_HUMAN
86 PsiBlast_CBE 67.7354% -57 - C1 -1BKM 6.7
3 PsiBlast_PDB 67.6168% -39 - C1 -1CWD 4.2 ?
4 PsiBlast_PDB 67.0368% -29 - C1 -1CWE 6.3 ?
72 PsiBlast_CBE 66.2055% -48 - C1 -1NZL 6.5
70 PsiBlast_CBE 65.7855% -53 - C1 -1NZV 6.4
78 PsiBlast_CBE 65.2855% -51 - C1 -1SHB 3.9
81 PsiBlast_CBE 65.2255% -51 - C1 -1P13 5.3 SRC_CHICK
76 PsiBlast_CBE 65.1955% -46 - C1 -1SPS 4.8 SRC_RSVSA
107 PsiBlast_CBE 65.0854% -52 - C1 -1O44 8.3
111 PsiBlast_CBE 64.2254% -51 - C1 -1SHD 6.1
67 PsiBlast_CBE 64.2055% -47 - C1 -1IS0 4.1
82 PsiBlast_CBE 64.0155% -33 - C1 -1A1A 6.2
83 PsiBlast_CBE 63.7155% -37 - C1 -1A1A 4.5 SRC_HUMAN
131 PsiBlast_CBE 63.5553%-145 - C1 -1KC2 5.9
121 PsiBlast_CBE 63.4054% -48 - C1 -1A09 5.7 SRC_HUMAN
120 PsiBlast_CBE 63.3854% -39 - C1 -1A09 5.3
75 PsiBlast_CBE 63.3155% -40 - C1 -1SPS 4.4 SRC_RSVSA
116 PsiBlast_CBE 63.0654% -41 - C1 -1A1C 6.8
125 PsiBlast_CBE 62.8554% -56 - C1 -1A07 3.5 SRC_HUMAN
68 PsiBlast_CBE 62.8555% -50 - C1 -1IS0 4.7 SRC_RSVSA
113 PsiBlast_CBE 62.7254% -50 - C1 -1HCS 3.5
74 PsiBlast_CBE 62.6555% -38 - C1 -1SPS 5.2
109 PsiBlast_CBE 62.5354% -49 - C1 -1O42 7.6
79 PsiBlast_CBE 62.3255% -47 - C1 -1SHA 4.7
93 PsiBlast_CBE 62.0854% -61 - C1 -1O4L 4.0
85 PsiBlast_CBE 62.0655% -56 - C1 -1F1W 5.9
98 PsiBlast_CBE 61.9854% -61 - C1 -1O4E 3.4
80 PsiBlast_CBE 61.8755% -55 - C1 -1P13 4.9
69 PsiBlast_CBE 61.5255% -55 - C1 -1SKJ 6.5
272 Fugue 61.4568% 86 - C1 -1LKK 7.2 LCK_HUMAN
103 PsiBlast_CBE 61.3854% -54 - C1 -1O48 8.4
94 PsiBlast_CBE 61.2654% -56 - C1 -1O4K 3.5
97 PsiBlast_CBE 61.2054% -46 - C1 -1O4H 3.7
96 PsiBlast_CBE 61.1554% -61 - C1 -1O4I 2.3
134 PsiBlast_CBE 61.1254% -54 - C1 -1O4G 4.1
100 PsiBlast_CBE 61.1154% -45 - C1 -1O4B 6.0
87 PsiBlast_CBE 61.0654% -60 - C1 -1O4R 5.5
135 PsiBlast_CBE 61.0054% -53 - C1 -1O4F 2.4
92 PsiBlast_CBE 60.8754% -62 - C1 -1O4M 3.1
119 PsiBlast_CBE 60.6754% -46 - C1 -1A1B 5.9 SRC_HUMAN
106 PsiBlast_CBE 60.5254% -49 - C1 -1O45 7.2
95 PsiBlast_CBE 60.5154% -57 - C1 -1O4J 2.9
105 PsiBlast_CBE 60.4454% -54 - C1 -1O46 8.2
101 PsiBlast_CBE 60.4254% -49 - C1 -1O4A 7.0
110 PsiBlast_CBE 60.2754% -61 - C1 -1O41 2.7
122 PsiBlast_CBE 60.2454% -43 - C1 -1A08 6.2
115 PsiBlast_CBE 60.2154% -54 - C1 -1A1E 6.3 SRC_HUMAN
108 PsiBlast_CBE 60.1954% -52 - C1 -1O43 6.5
124 PsiBlast_CBE 60.0754% -39 - C1 -1A07 3.5
99 PsiBlast_CBE 60.0154% -54 - C1 -1O4D 2.4
91 PsiBlast_CBE 59.9954% -53 - C1 -1O4N 3.4
123 PsiBlast_CBE 59.6254% -48 - C1 -1A08 5.6 SRC_HUMAN
61 PsiBlast_CBE 59.2261% -21 - C1 -1AOU 4.9
88 PsiBlast_CBE 59.1254% -53 - C1 -1O4Q 3.5
112 PsiBlast_CBE 58.9354% -35 - C1 -1HCT 2.8
104 PsiBlast_CBE 58.9154% -45 - C1 -1O47 7.8
89 PsiBlast_CBE 58.8854% -59 - C1 -1O4P 5.2
62 PsiBlast_CBE 58.6561% -33 - C1 -1AOT 2.4
90 PsiBlast_CBE 58.6454% -52 - C1 -1O4O 3.0
118 PsiBlast_CBE 58.5354% -35 - C1 -1A1B 5.9
257 HHSearch 58.4935% -94 - C1 -3PQZ 2.4 GRB7_HUMAN
102 PsiBlast_CBE 58.2854% -50 - C1 -1O49 6.9
114 PsiBlast_CBE 57.8754% -35 - C1 -1A1E 6.5
117 PsiBlast_CBE 56.5354% -45 - C1 -1A1C 6.4 SRC_HUMAN
65 PsiBlast_CBE 46.5061% -4 - C1 -4U17 3.2 FYN_HUMAN
63 PsiBlast_CBE 45.6161% 5 - C1 -4U17 2.1 ?