@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : F5GY53_HUMAN: (2017-06-02 )
WFHGTLSRVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKASHLRLSLNGHGQCHVQHLWFQSVLDMLRHF

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1CSZ)

[Raw transfer]




CHAIN_J_10(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_H_8(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_I_9(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_G_7(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_L_12(2HDX)

[Raw transfer]

-

CHAIN_K_11(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

25 PsiBlast_CBE 92.7175%-185 - C3 -2HDX 6.1 SH2B1_MOUSE
1 PsiBlast_PDB 91.9093%-156 - C3 -1RQQ Calc... SH2B2_RAT
21 PsiBlast_CBE 91.6675%-182 - C3 -2HDX 6.7
22 PsiBlast_CBE 90.8975%-182 - C3 -2HDX 6.0 SH2B1_MOUSE
4 PsiBlast_PDB 90.6375%-185 - C3 -2HDX 6.5 SH2B1_MOUSE
23 PsiBlast_CBE 88.6975%-180 - C3 -2HDX 5.4 SH2B1_MOUSE
24 PsiBlast_CBE 88.0175%-181 - C3 -2HDX 6.0 SH2B1_MOUSE
131 HHSearch 86.8677% 0 - C- -2HDV - SH2B1_MOUSE -
3 PsiBlast_PDB 85.5875% 0 - C- -2HDV - SH2B1_MOUSE -
2 PsiBlast_PDB 84.6792%-150 - C3 -1RPY Calc... SH2B2_RAT
138 HHSearch 71.6929%-136 - C3 -1D4T Calc... SH21A_HUMAN
142 HHSearch 70.2829%-173 - C3 -3OV1 Calc... GRB2_HUMAN
137 HHSearch 69.6129%-137 - C3 -1KA6 Calc... SH21A_HUMAN
141 HHSearch 68.8726%-146 - C3 -1I3Z Calc... SH21B_MOUSE
5 PsiBlast_PDB 68.1228%-175 - C3 -1K9A - CSK_RAT -
6 PsiBlast_PDB 67.8528%-188 - C3 -2RSY - CSK_RAT -
144 HHSearch 66.8928%-149 - C3 -2MK2 Calc... SHIP2_HUMAN
129 HHSearch 66.6229%-164 - C3 -3WA4 Calc... GRB2_HUMAN
133 HHSearch 65.5125%-168 - C3 -1R1P Calc... GRAP2_MOUSE
136 HHSearch 64.5026%-190 - C3 -2GSB Calc...
147 Fugue 57.6132% 39 - C3 -1CSZ Error