@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : F5GYM4_HUMAN: (2017-06-02 )
WFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTERGQCRVQHLHFPSVVDMLHHF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_J_10(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_I_9(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_H_8(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_L_12(2HDX)

[Raw transfer]

-

CHAIN_K_11(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_G_7(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

141 HHSearch 100.0077% 0 - C- -2HDV - SH2B1_MOUSE -
1 PsiBlast_PDB 99.2376% 0 - C- -2HDV - SH2B1_MOUSE -
25 PsiBlast_CBE 94.3676%-187 - C1 -2HDX 6.0 SH2B1_MOUSE
22 PsiBlast_CBE 93.8176%-186 - C1 -2HDX 5.9 SH2B1_MOUSE
23 PsiBlast_CBE 92.3076%-181 - C1 -2HDX 5.2 SH2B1_MOUSE
21 PsiBlast_CBE 91.6576%-188 - C1 -2HDX 6.8
24 PsiBlast_CBE 91.1576%-185 - C1 -2HDX 6.1 SH2B1_MOUSE
2 PsiBlast_PDB 91.1576%-191 * C1 *2HDX 6.5 SH2B1_MOUSE
3 PsiBlast_PDB 83.2873%-162 - C1 -1RQQ Calc... SH2B2_RAT
4 PsiBlast_PDB 71.9271%-155 - C1 -1RPY Calc... SH2B2_RAT
153 HHSearch 68.3330%-190 - C1 -2GSB Calc...
158 HHSearch 66.2729%-140 - C1 -1D4T Calc... SH21A_HUMAN
155 HHSearch 64.8229%-141 - C1 -1KA6 Calc... SH21A_HUMAN
152 HHSearch 64.6828%-179 - C1 -3OV1 Calc... GRB2_HUMAN
139 HHSearch 62.4233% -93 - C1 -1JU5 Calc... CRK_HUMAN
156 HHSearch 61.9522%-145 - C1 -1I3Z Calc... SH21B_MOUSE
142 HHSearch 61.2328%-164 - C1 -3WA4 Calc... GRB2_HUMAN
154 HHSearch 59.9833%-159 - C1 -4EIH Calc...
147 HHSearch 58.3429%-179 - C1 -2EO3 Calc... CRKL_HUMAN
8 PsiBlast_PDB 58.2841%-174 - C1 -1TCE - -